Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3)

In Stock
Code CSB-EP883438HU
Abbreviation Recombinant Human AK3 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP883438HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP883438HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
AK3
Uniprot No.
Research Area
Metabolism
Alternative Names
Adenylate kinase 3 alpha-like 1; Adenylate kinase 3; Adenylate kinase 3, formerly; adenylate kinase 6, adenylate kinase 3 like 1; AK 3; AK3; AK3, formerly; AK3L1; AK4; AK4, mouse, homolog of; AK6; AKL3L; AKL3L1; FIX; GTP:AMP phosphotransferase; GTP:AMP phosphotransferase, mitochondrial; KAD3_HUMAN; mitochondrial; OTTHUMP00000021015; OTTHUMP00000021016; RP11 6J24.4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-227aa
Target Protein Sequence
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The meticulously designed Recombinant Human AK3 is a valuable tool for advancing your metabolic research. This high-quality product features the full-length GTP:AMP phosphotransferase AK3, mitochondrial protein, also known as Adenylate kinase 3. The enzyme plays a vital role in cellular energy homeostasis and nucleotide metabolism.

Derived from E.coli, our Recombinant Human AK3 comprises an expression region of 1-227 amino acids, with N-terminal 10xHis-tagged and C-terminal Myc-tagged elements for simplified purification and detection. This product boasts a purity greater than 90%, as determined by SDS-PAGE, and is available in both liquid and lyophilized powder forms to suit a variety of experimental needs. Trust the precision-engineered Recombinant Human AK3 for unparalleled accuracy and reliability in your metabolism-focused research pursuits.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities.
Gene References into Functions
  1. These findings suggest that AK3 and SLIT2 may be potential candidates involved in genetic susceptibility to colorectal cancer PMID: 27888432
Subcellular Location
Mitochondrion matrix.
Protein Families
Adenylate kinase family, AK3 subfamily
Tissue Specificity
Highly expressed in heart, skeletal muscle and liver, moderately expressed in pancreas and kidney, and weakly expressed in placenta, brain and lung.
Database Links

HGNC: 17376

OMIM: 609290

KEGG: hsa:50808

STRING: 9606.ENSP00000371230

UniGene: Hs.732022

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*