Home
Protein
Recombinant Proteins
Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3)

Recombinant Human GTP:AMP phosphotransferase, mitochondrial (AK3)

^{In Stock}

Code	CSB-EP883438HU
Abbreviation	Recombinant Human AK3 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP883438HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP883438HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AK3.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

AK3

Uniprot No.

Q9UIJ7

Research Area

Metabolism

Alternative Names

Adenylate kinase 3 alpha-like 1; Adenylate kinase 3; Adenylate kinase 3, formerly; adenylate kinase 6, adenylate kinase 3 like 1; AK 3; AK3; AK3, formerly; AK3L1; AK4; AK4, mouse, homolog of; AK6; AKL3L; AKL3L1; FIX; GTP:AMP phosphotransferase; GTP:AMP phosphotransferase, mitochondrial; KAD3_HUMAN; mitochondrial; OTTHUMP00000021015; OTTHUMP00000021016; RP11 6J24.4

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-227aa

Target Protein Sequence

MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.6 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The meticulously designed Recombinant Human AK3 is a valuable tool for advancing your metabolic research. This high-quality product features the full-length GTP:AMP phosphotransferase AK3, mitochondrial protein, also known as Adenylate kinase 3. The enzyme plays a vital role in cellular energy homeostasis and nucleotide metabolism.

Derived from E.coli, our Recombinant Human AK3 comprises an expression region of 1-227 amino acids, with N-terminal 10xHis-tagged and C-terminal Myc-tagged elements for simplified purification and detection. This product boasts a purity greater than 90%, as determined by SDS-PAGE, and is available in both liquid and lyophilized powder forms to suit a variety of experimental needs. Trust the precision-engineered Recombinant Human AK3 for unparalleled accuracy and reliability in your metabolism-focused research pursuits.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities.

Gene References into Functions