Recombinant Human Glioma pathogenesis-related protein 1 (GLIPR), partial

In Stock
Code CSB-EP009503HU
Abbreviation Recombinant Human GLIPR1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GLIPR1
Uniprot No.
Research Area
Cancer
Alternative Names
CRISP 7; CRISP7; GLI pathogenesis related 1; GLI pathogenesis-related 1 (glioma); Glioma pathogenesis related protein 1; Glioma pathogenesis-related protein 1; GLIP1_HUMAN; GliPR 1; GLIPR; GLIPR1; Protein RTVP-1; RELATED TO TESTIS SPECIFIC; VESPID; AND PATHOGENESIS PROTEINS 1; RTVP 1; RTVP1; Testes specific vespid and pathogenesis protein 1; testes-specific vespid and pathogenesis protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-232aa
Target Protein Sequence
ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Data found that GLIPR1 expression level was low in human bladder cancer tissues. Also, GLIPR1 was shown to inhibit the expression of TPX2. PMID: 28799673
  2. High GLIPR1 expression is associated with cisplatin resistance in lung cancer. PMID: 28771580
  3. The present study identified GLIPR1 and miR-16 as key components for regulating the proliferation, migration, invasion and cancer-initiating cells in osteosarcoma PMID: 27460987
  4. This study reveals a novel pathway that PRMT5/WDR77 regulates GLIPR1 expression to control lung cancer cell growth. PMID: 26988096
  5. Overexpression of RTVP-1 in human neural stem cells induced mesenchymal differentiation, whereas silencing of RTVP-1 in glioma stem cells (GSCs) decreased the mesenchymal transformation and stemness of these cells. PMID: 26267319
  6. RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein. PMID: 26305187
  7. Data indicate that combining adenoviral vector-mediated GLIPR1 gene therap (AdGLIPR1) with radiotherapy may achieve additive or synergistic tumor control in selected prostate and bladder tumors. PMID: 23433894
  8. Based on the observed overexpression in AML samples, GliPR1 should be further explored as a potential target for AML PMID: 24008279
  9. miR-137 inhibits Glioblastom stem cell self-renewal and promotes their differentiation by targeting RTVP-1 which down-regulates CXCR4. PMID: 23714687
  10. GLIPR1 interacts with Hsc70, and GLIPR1 overexpression or Hsc70 knockdown leads to transcriptional suppression of AURKA and TPX2. PMID: 23333597
  11. GLIPR1 core structure has a conserved central cavity via which CAP proteins are likely to bind to shared ligands. PMID: 21931216
  12. Data show that the expression of GLIPR1 and c-Myc were inversely correlated in prostate cancer. PMID: 22025562
  13. RTVP-1 plays a role in the effect of serum response factor on glioma cell migration PMID: 21777672
  14. demonstrate that GLIPR1 is a methylation-silenced gene in the acute myeloid leukemia patients PMID: 21922325
  15. GLIPR1 expression is downregulated or even lost by promoter methylation in acute myeloid leukemia. PMID: 19483285
  16. X-ray data have been collected to beyond 1.9 A resolution from a crystal of GLIPR1 that belonged to the orthorhombic space group P2(1)2(1)2 with average unit-cell parameters a = 85.1, b = 79.5, c = 38.9 A and either a monomer or dimer PMID: 21045302
  17. Induction of GliPR expression by HIV-1 was confirmed in P4-CCR5 cells. PMID: 20356381
  18. Expression of the human RTVP-1 gene is down-regulated in human prostate cancer specimens compared with normal human prostate tissue at the mRNA and protein levels. PMID: 14871827
  19. In this study we report the identification and characterization of a novel p53 target gene cluster that includes human RTVP1 (hRTVP-1) together with two GLIPR1L genes (GLIPR1L1 and GLIPR1L2) on human chromosome 12q21 and mouse Rtvp1 PMID: 16714093
  20. RTVP-1b is a novel splice variant of human RTVP-1, which was isolated from the U87 glioma cell line PMID: 17825796
  21. a role for GLIPR1/RTVP-1 deregulation early in Wilms tumorigenesis. PMID: 18030365
  22. GLIPR1 is a proapoptotic tumor suppressor acting through the ROS-JNK pathway. PMID: 18199537

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Protein Families
CRISP family
Tissue Specificity
According to PubMed:8973356, it is ubiquitously expressed with high levels in lung and kidney and low levels in heart and liver. Highly expressed in cell lines derived from nervous system tumors arising from glia, low or absent in non-glial-derived nervou
Database Links

HGNC: 17001

OMIM: 602692

KEGG: hsa:11010

STRING: 9606.ENSP00000266659

UniGene: Hs.205558

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*