Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

GLP2R

Uniprot No.

O95838

Research Area

Cell Biology

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-173aa

Target Protein Sequence

MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression of recombinant Human GLP2R protein involves transfecting mammalian cells with a DNA expression vector carrying the gene for the protein of interest (1-173aa). After transfection, the cells are cultured to produce the desired protein. A C-terminal 10xHis tag is fused to the protein. The recombinant Human GLP2R protein is collected and purified from the cell lysate through affinity purification, attaining a purity greater than 85%, as determined by SDS-PAGE.

Target Background

Function

This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

GLP2R expression was significantly increased in gastric chief cells in OB and OWD patients. PKCzeta expression was also significantly increased. This is the first evidence of increased GLP2R expression in chief cells of patients with severe obesity regardless of diabetes status. PMID: 28337026
GLP-2 augmented BRIN BD11 beta-cell proliferation, but was less efficacious in 1.1B4 cells. These data highlight the involvement of GLP-2 receptor signalling in the adaptations to pancreatic islet cell stress. PMID: 28746825
This is the first time that human Epicardial adipose tissue is found to express both GLP-1R and GLP-2R genes. PMID: 28514806
Report gastrointestinal GLP-2 receptor and limited utility of GLP-2 in the management of inflammatory intestinal disorders. PMID: 24875097
GLP-2 receptors are highly expressed in gastrointestinal stromal tumors and Crohn's disease. PMID: 22951144
GLP2R encodes a G protein-coupled receptor and involved in proliferative and anti-apoptotic cellular responses. PMID: 21326311
docking studies were performed between the N-terminal extracellular domain of GLP-2 receptor and the GLP-2 hormone PMID: 21167157
glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways PMID: 15471943
GLP-2 in the gut acts by activating receptors on the subepithelial myofibroblasts, causing the release of growth factors, which in turn stimulate intestinal growth PMID: 15544847
GLP-2 receptor C terminus has a role in modulating beta-arrestin-2 association but not ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation PMID: 15817468
GLP-2-induced stimulation of blood flow is mediated by vasoactive neurotransmitters that are colocalized with GLP-2R in 2 functionally distinct cell types within the gastrointestinal tract PMID: 16401478
Endogenously expressing GLP-2 receptor encoding mRNA and protein was identified in intestinal cell lines. PMID: 16448646
Sustained direct or indirect modulation of GLP-2R signaling does not modify intestinal tumor cell growth or survival. PMID: 18829546

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Database Links

HGNC: 4325

OMIM: 603659

KEGG: hsa:9340

STRING: 9606.ENSP00000262441

UniGene: Hs.248202

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-MP009515HU1
Abbreviation	Recombinant Human GLP2R protein, partial
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage