Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial

In Stock
Code CSB-MP009515HU1
Abbreviation Recombinant Human GLP2R protein, partial
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-173aa
Target Protein Sequence
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of recombinant Human GLP2R protein involves transfecting mammalian cells with a DNA expression vector carrying the gene for the protein of interest (1-173aa). After transfection, the cells are cultured to produce the desired protein. A C-terminal 10xHis tag is fused to the protein. The recombinant Human GLP2R protein is collected and purified from the cell lysate through affinity purification, attaining a purity greater than 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. GLP2R expression was significantly increased in gastric chief cells in OB and OWD patients. PKCzeta expression was also significantly increased. This is the first evidence of increased GLP2R expression in chief cells of patients with severe obesity regardless of diabetes status. PMID: 28337026
  2. GLP-2 augmented BRIN BD11 beta-cell proliferation, but was less efficacious in 1.1B4 cells. These data highlight the involvement of GLP-2 receptor signalling in the adaptations to pancreatic islet cell stress. PMID: 28746825
  3. This is the first time that human Epicardial adipose tissue is found to express both GLP-1R and GLP-2R genes. PMID: 28514806
  4. Report gastrointestinal GLP-2 receptor and limited utility of GLP-2 in the management of inflammatory intestinal disorders. PMID: 24875097
  5. GLP-2 receptors are highly expressed in gastrointestinal stromal tumors and Crohn's disease. PMID: 22951144
  6. GLP2R encodes a G protein-coupled receptor and involved in proliferative and anti-apoptotic cellular responses. PMID: 21326311
  7. docking studies were performed between the N-terminal extracellular domain of GLP-2 receptor and the GLP-2 hormone PMID: 21167157
  8. glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways PMID: 15471943
  9. GLP-2 in the gut acts by activating receptors on the subepithelial myofibroblasts, causing the release of growth factors, which in turn stimulate intestinal growth PMID: 15544847
  10. GLP-2 receptor C terminus has a role in modulating beta-arrestin-2 association but not ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation PMID: 15817468
  11. GLP-2-induced stimulation of blood flow is mediated by vasoactive neurotransmitters that are colocalized with GLP-2R in 2 functionally distinct cell types within the gastrointestinal tract PMID: 16401478
  12. Endogenously expressing GLP-2 receptor encoding mRNA and protein was identified in intestinal cell lines. PMID: 16448646
  13. Sustained direct or indirect modulation of GLP-2R signaling does not modify intestinal tumor cell growth or survival. PMID: 18829546

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links

HGNC: 4325

OMIM: 603659

KEGG: hsa:9340

STRING: 9606.ENSP00000262441

UniGene: Hs.248202

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*