Recombinant Human Glutathione S-transferase A4 (GSTA4)

Code CSB-MP009973HUd7
Abbreviation Recombinant Human GSTA4 protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
GSTA4
Uniprot No.
Research Area
Metabolism
Alternative Names
GST class-alpha member 4Glutathione S-transferase A4-4
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-222aa
Target Protein Sequence
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.5 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).
Gene References into Functions
  1. These findings demonstrate GSTA4 activation during 4-HNE-induced neoplastic transformation in colorectal carcinogenesis. GSTA4 is a potential surrogate biomarker for CRC screening and should provide novel approaches for chemoprevention. PMID: 27065323
  2. Decreased gene expression of GSTA4 is associated with drug resistance in cervical cancer. PMID: 24403508
  3. drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells. PMID: 23330092
  4. GSTA4 down-regulation and the concomitant increase in 4-hydroxynonenal adducts in muscle are indicative of susceptibility to infection in individuals with severe thermal injuries. PMID: 22038048
  5. Data show that mandatory overexpression of hGSTA4 by transient transfection in KYSE30 cells and attenuation of HNE-induced EGFR phosphorylation. PMID: 21751261
  6. analysis of four novel mutations that change the function of leukotriene C(4) synthase and are associated with increased risk of venous thromboembolism and ischemic stroke PMID: 20456754
  7. Gsta4/GSTA4 is a novel susceptibility gene for NMSC that affects risk in both mice and humans. PMID: 20966433
  8. Results indicate that downregulation of GSTA4 in adipose tissue leads to increased protein carbonylation, ROS production, and mitochondrial dysfunction and may contribute to the development of insulin resistance and type 2 diabetes. PMID: 20150287
  9. GSTA4-4 exploits the hydroxyl group of either 4R- or 4S-hydroxynonenal (HNE), while specifically binding HNE and glutathione (GSH) to maintain high catalytic efficiency linked with stereoselective product formation for both enantiomeric substrates. PMID: 20085333
  10. null mice had a significantly lower survival time than wild-type controls when chronically treated with relatively low doses of paraquat, a finding consistent with a role of glutathione transferase A4-4 in the defense against oxidative stress PMID: 14761685
  11. We now demonstrate that hGSTA4-transfection also causes a profound change in the expression of genes involved in cell adhesion, cell cycle control, proliferation, cell growth, and apoptosis. PMID: 16005854
  12. we observed a single nucleotide polymorphism (SNP) G351A leading to the silent mutation Gln117Gln.No significant difference was observed in the distribution of this GSTA4 polymorphism between Parkinson disease individuals and healthy controls PMID: 16054170
  13. The effect of over-expression of GSTA4 mRNA on the sensitivity of HepG2 cells to 4-hydroxynonenal injury is reported. PMID: 17553661
  14. These results demonstrate that oxidative stress mediated disruption of tight junctions in endothelial cells may be attenuated by hGSTA4-4 expression. PMID: 18080870
  15. GSTA4-4 may play an important defensive role against atherogenesis through detoxification of 4-HNE and upregulation of inducible nitric oxide synthase PMID: 18485437
  16. genetic polymorphisms in GSTA4 had modification effects on smoking-related lung cancer risk, particularly among patients with squamous cell carcinoma and small-cell-lung-cancer. PMID: 18767114
  17. 4-HNE is involved in p53-mediated signaling in in vitro cell cultures as well as in vivo that can be regulated by glutathione transferase PMID: 18930016

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
GST superfamily, Alpha family
Tissue Specificity
Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
Database Links

HGNC: 4629

OMIM: 605450

KEGG: hsa:2941

STRING: 9606.ENSP00000359998

UniGene: Hs.485557

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*