Home
Protein
Recombinant Protein
Recombinant Human Glycophorin (GYPA), partial

Recombinant Human Glycophorin (GYPA), partial

^{In Stock}

Code	CSB-EP010074HU
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot No.

A0A0C4DFT7

Research Area

Cardiovascular

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

20-91aa

Target Protein Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

34.9kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 20-91 constitute the expression domain of recombinant Human GYPA. The calculated molecular weight for this GYPA protein is 34.9 kDa. This protein is generated in a e.coli-based system. The GYPA gene fragment has been modified by fusing the N-terminal GST tag, providing convenience in detecting and purifying the recombinant GYPA protein during the following stages.

Glycophorin (GYPA) is a glycoprotein expressed on the surface of red blood cells and plays a crucial role in maintaining the structural integrity of the erythrocyte membrane. GYPA is a member of the glycophorin gene family and contains N-linked glycosylation sites, contributing to the carbohydrate composition of the cell membrane. GYPA serves as a receptor for the malarial parasite Plasmodium falciparum, aiding in its invasion of red blood cells. Besides its involvement in malaria pathogenesis, GYPA also participates in blood group antigen formation and is a target for antibodies in autoimmune hemolytic anemia. Understanding the function of GYPA is essential for elucidating erythrocyte biology, host-pathogen interactions, and blood-related disorders.