Recombinant Human Growth/differentiation factor 5 (GDF5)

Code CSB-EP009349HU
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
GDF-5;Bone morphogenetic protein 14;BMP-14;Cartilage-derived morphogenetic protein 1;CDMP-1;Lipopolysaccharide-associated protein 4;LAP-4;LPS-associated protein 4;Radotermin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
382-501aa
Target Protein Sequence
APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
20.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction. Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG. Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes.
Gene References into Functions
  1. We found a strong association between the TT genotype and the risk of developing Knee Osteoarthritis (OR = 1.7, 95% CI = 1.12-2.8, p = 0.014), but not in the heterozygous TC state (OR = 1.56, CI 95% = 0.58-4.17, p = 0.367). PMID: 30044130
  2. study shows that there exists a relationship between GDF5 (SNP rs143383) and Developmental dysplasia of the hip (DDH) in our population. Second, we found for the first time that the genotype TT and the T allele were overly expressed in the patients and the fathers. More studies on the confirmation of this genetic marker for DDH are called for. PMID: 29797005
  3. Two Pakistani families with sequence variants in GDF5 and TRPS1 causing brachydactyly type C and tricho-rhino-phalangeal syndrome type III are described. PMID: 29436063
  4. The dysfunctional gene GDF5 was successfully corrected in adipose tissue-derived mesenchymal stem cells using a pair of transcription activatorlike effector nucleases. PMID: 29393424
  5. No association has been found between GDF5 +104 T/C promoter polymorphism and osteoarthritis in the Eastern Turkey population. PMID: 28886316
  6. The results of the current study revealed that SNP rs143383 of GDF5 is a compelling risk factor for knee OA [Osteoarthritis] and that GDF5 has an etiological effect on the development of OA [Osteoarthritis]. PMID: 29056119
  7. A Study of IL-1beta, MMP-3, TGF-beta1, and GDF5 Polymorphisms and Their Association with Primary Frozen Shoulder in a Chinese Han Population PMID: 28676856
  8. BMP-14 rs143383 polymorphism reduced the susceptibility to knee osteoarthritis (OA) and hand OA not only in total analysis but also in subgroup analysis; BMP-14 rs143383 polymorphism may be a protective factor against OA occurrence PMID: 29049177
  9. The structure of Grem2-GDF5 complex has revealed a number of key findings for DAN-family mediated BMP2 inhibition. PMID: 27524626
  10. miR-615-3p negatively regulates the osteogenic differentiation of hLF cells through post-transcriptionally suppressing osteogenic regulators GDF5 and FOXO1. PMID: 28460412
  11. p38, c-jun, and NFkappaB pathways activated during intervertebral disc degeneration by IL-1beta but not GDF-5 PMID: 27391542
  12. GDF5 elicited significant (p < 0.05) changes in the expression of anabolic, catabolic and hypertrophic genes with several consistent effects in healthy donors and in OA patients PMID: 28481944
  13. GDF5 was up regulated in patients after chronic rhinosinusitis developing osteitis. PMID: 27888647
  14. Titanium (Ti) surface modification with the combination of hBMP-2 and hGDF-5 for the two growth factor-coated Ti implants can improve the clinical properties of implants for orthopedic and dental applications. PMID: 28124978
  15. he large array of modular enhancers for Gdf5 provide a new foundation for studying the spatial specificity of joint patterning in vertebrates, as well as new candidates for regulatory regions that may also influence osteoarthritis risk in human population PMID: 27902701
  16. The purpose of this study is to investigate the immunohistochemical expression of cytokeratin 18 (CK18) and the reactivity to GDF5 (CDMP-1), called the morphogenetic protein-1, cartilage-derived, in lingual squamous cell carcinoma. PMID: 27151703
  17. homozygous sequence variants in the GDF5 gene underlie acromesomelic dysplasia type-grebe in consanguineous families PMID: 27577507
  18. The prevention of IL-1Beta-induced nucleus pulposus extracellular matrix degeneration by miR-7 silencing was attenuated by GDF5 siRNA. PMID: 27583982
  19. Mutations in three genes (GDF5, NPR2, BMPR1B) have been reported to cause different forms of acromesomelic dysplasia PMID: 26926249
  20. we demonstrate that the transforming growth factor-beta1 and the growth differentiation factor 5 synergistically drive the nucleopulpogenic differentiation process. The commitment of the hASCs was robust and highly specific as attested by the expression of NP-related genes characteristic of young healthy human NP cells PMID: 26661057
  21. The data suggest that Ad-GDF-5 gene therapy is a potential treatment for IDD, which restores the functions of degenerative intervertebral disc through enhancing the ECM production of human NP cells. PMID: 26739524
  22. An association of SNP in GDF5 with temporomandibular joint osteoarthritis in female Han Chinese. PMID: 25757091
  23. results demonstrate that SNP rs143383 of GDF5 is a compelling risk factor for both knee and hand osteoarthritis (OA) and provide further support for GDF5 in the etiology of OA [meta-analysis] PMID: 25894512
  24. Two novel homozygous missense mutations in the GDF5 gene cause brachydactyly type C. PMID: 25820810
  25. our results showed that GDF-5 and BMPRII expressed both in normal and degenerated intervertebral disc tissues, and GDF-5 might have an inhibition effect on degenerated lumbar intervertebral discs PMID: 25755766
  26. This meta-analysis finds that the C allele and CC genotype of the GDF5 gene are protective for knee osteoarthritis susceptibility. PMID: 25467786
  27. Our results revealed that the GDF5 SNP was associated with susceptibility to the meniscus injury and postoperative function recovery in Chinese male soldiers. PMID: 24227118
  28. missense mutations p.T201P and p.L263P interfere with the protein structure and thereby reduce the amount of fully processed, biologically active GDF5, finally causing the clinical loss of function phenotype. PMID: 25092592
  29. The proregion is stabilized by an intramolecular disulfide bond. The isolated proregion folds independently of the mature domain. PMID: 25174448
  30. Growth differentiation factor 5 and canonical Wnt signaling may contribute to molecular mechanisms of osteoarthritis. PMID: 24561281
  31. These results suggest that obesity leads to upregulation of GDF5 expression responsible for the promotion of brown adipogenesis through a mechanism relevant to activation of the NF-kappaB pathway. PMID: 25223801
  32. results suggested that GDF5 polymorphism is associated with susceptibility to symptomatic lumbar disc herniation in Chinese Han population and type II collagen in the nucleus pulposus may be a factor in susceptibility to symptomatic lumbar disc herniation PMID: 24105021
  33. Osteoarthritis chondrocytes do not respond in a predictable manner to culture with exogenous GDF5. PMID: 24466161
  34. High GDF5 expression is associated with osteoarthritis. PMID: 24861163
  35. The expression of growth differentiation factor 5 (GDF5) and aggrecan in 15 cases of salivary gland pleomorphic adenomas, was investigated. PMID: 24398992
  36. established an association between two SNPs (rs224332 and rs224333) of GDF5 and DDH development in a female Chinese population. PMID: 24114442
  37. In vitro findings suggest that the degenerating disc milieu, with high proinflammatory cytokine levels, may limit expression of GDF-5, resulting in limited regenerative capacity of the intact disc. PMID: 24582800
  38. These novel insights into the biology of GDF5 might also provide further clues on the pathophysiology of OA. PMID: 24098149
  39. The novel missense mutation p.Leu176Pro causes impaired secretion of GDF5 in Brachydactyly type C and mild Grebe type chondrodyslplasia. PMID: 23812741
  40. GDF5 is the only osteoarthritis susceptibility gene so far identified with definite evidence.[Review] PMID: 24003854
  41. Overall, a statistically significant association was found between the +104T/C polymorphism of GDF5 and risk of knee osteoarthritis PMID: 23151597
  42. GDF5 harbors a C/A transversion located -41 bp relative to the transcription start site that leads to increased gene expression. PMID: 22929025
  43. GDF5 polymorphisms are associated with susceptibility to low back pain during military training in Chinese soldiers. PMID: 23725396
  44. In conclusion, the rs143383 variant was not found to associate with the risk of ACL rupture. PMID: 23090674
  45. we have identified four trans-acting factors that are binding to GDF5, three of which are modulating GDF5 expression via the OA susceptibility locus rs143383. PMID: 23825960
  46. Although the effect size of the association between OA and GDF5 is small, there is suggestive evidence for an association. PMID: 23423687
  47. GDF5 regulates TGF-beta-dependent angiogenesis in breast carcinoma cells. PMID: 23226264
  48. Growth differentiation factor 5 modulation of chondrogenesis of self-assembled constructs involves gap junction-mediated intercellular communication. PMID: 23121099
  49. analysis of positive selection on the osteoarthritis-risk and decreased-height associated variants at the GDF5 gene in East Asians PMID: 22905146
  50. Our findings in 5 population cohorts from Northern Europe indicate that a variant in the GDF5 gene is a risk factor for lumbar disc degeneration in women. PMID: 21360499

Show More

Hide All

Involvement in disease
Acromesomelic chondrodysplasia, Grebe type (AMDG); Acromesomelic chondrodysplasia, Hunter-Thompson type (AMDH); Brachydactyly C (BDC); Du Pan syndrome (DPS); Symphalangism, proximal 1B (SYM1B); Multiple synostoses syndrome 2 (SYNS2); Brachydactyly A2 (BDA2); Osteoarthritis 5 (OS5); Brachydactyly A1, C (BDA1C)
Subcellular Location
Secreted. Cell membrane.
Protein Families
TGF-beta family
Tissue Specificity
Predominantly expressed in long bones during embryonic development. Expressed in monocytes (at protein level).
Database Links

HGNC: 4220

OMIM: 112600

KEGG: hsa:8200

STRING: 9606.ENSP00000363489

UniGene: Hs.1573

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*