Recombinant Human Heat shock protein beta-2 (HSPB2)

Code CSB-EP614956HU
Abbreviation Recombinant Human HSPB2 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HSPB2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
DMPK-binding protein; Heat shock 27kD protein 2; Heat shock 27kDa protein 2; Heat shock protein beta-2; Heat-shock protein beta-2; Hs.78846; HSP27; HspB2; HSPB2_HUMAN; LOH11CR1K; MGC133245; MKBP
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-182aa
Target Protein Sequence
MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.2kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate the kinase DMPK.
Gene References into Functions
  1. in differentiating myoblasts, nuclear HSPB2 compartments sequester lamin A. PMID: 28854361
  2. HSPB2 competes with HSPB8 for binding to BAG3. In contrast, HSPB3 negatively regulates HSPB2 association with BAG3. PMID: 28181153
  3. HspB2 has roles in maintaining ATP levels and as well as chaperone-dependent functions for metabolic homeostasis PMID: 26465331
  4. Results suggest a limited function of alphaB-crystallin and HSP27 in preventing abnormal tau protein deposition in glial cells and neurons; in addition, the expression of alphaB-crystallin phosphorylated at Ser59 may act as a protective factor in glial cells. PMID: 24985029
  5. These findings provide novel insights into the role of p53 as a regulator of bidirectional gene pair HspB2/alpha B-crystallin-mediated ROS and the Warburg effect PMID: 24859470
  6. Study shows that HspB2 oligomers exchange subunits. PMID: 22272249
  7. promoter methylation of heat shock protein B2 is a novel molecular biomarker in human esophageal squamous cell carcinoma PMID: 21258768
  8. Reveal a novel function of HspB2 as an anti-apoptotic protein that negatively regulates apical caspase 3/8 activation in the extrinsic apoptotic pathway. PMID: 20087649
  9. Hsp27, but not the classic Hsp60 and Hsp70, may be associated with the development bronchiolitis obliterans syndrome. PMID: 20456980
  10. Sodium salicylate can induce the expression of HSP27 in human lens epithelial cells. PMID: 19513626
  11. analysis of CEA-, Her2/neu-, BCRP- and Hsp27-positive microparticles in breast cancer patients PMID: 20592365
  12. HSP27 is linked to multi-drug resistance in cell line HepG2/VCR. PMID: 17524270
  13. The abnormal expression of 14-3-3 sigma and HSP27 is significantly associated with lymph node metastasis in colorectal cancer. PMID: 20336542
  14. 5-fluorouracil & carboplatin specifically induce expression of Hsp27 in hepatoma cells. siRNA knockdown of Hsp27 diminishes survival of drug-exposed cells. PMID: 19901540
  15. HSP27 confers reresistance to androgen ablation and chemotherapy in prostate cancer cells through eIF4E PMID: 20101233
  16. PM induces ROS generation in human lung endothelium, resulting in oxidative stress-mediated EC barrier disruption via p38 MAPK- and HSP27-dependent pathways. PMID: 19520919
  17. study indicate that monocytes do not trigger apoptosis of vascular endothelial cells; proapoptotic activation mediated by PUMA seemed to be counterbalanced by significant increase of antiapoptotic HSP70, HSP27 and especially phospho-HSP27 proteins level PMID: 20065497
  18. HSP27 and p53 protein levels play a key role(s) in heat shock-mediated switch of glucose depreivation-induced necrosis to apoptosis. PMID: 20043073
  19. Small interfering RNA-mediated silencing of heat shock protein 27 (HSP27) Increases chemosensitivity to paclitaxel by increasing production of reactive oxygen species in ovarian cancer. PMID: 19930842
  20. HSP27 and alphaB-crystallin are increased, phosphorylated and localized in aggresomes when proteasome activity is inhibited PMID: 11926998
  21. HSP27 nuclear staining can serve as a sensitive marker for skin irritation or cellular stress in excised skin PMID: 12473058
  22. HSP72 biosynthesis was analyzed by an image processing, computer-assisted imaging method in an endothelial vascular cell line and compared to a hand-calculated method. No differences were seen. PMID: 12503731
  23. Hsp27 regulates apoptosis through an ability to interact with key components of the apoptotic signalling pathway [review] PMID: 12510153
  24. hsp72 reduces caspase-3-mediated proteolysis of FAK, an anti-apoptotic protein PMID: 12611892
  25. Hsp27 plays a significant role in the IFN-gamma-induced sensitization of oral SCC cells to anticancer drugs PMID: 12700631
  26. Data show that heat shock protein 72 suppressed extracellular signal-regulated kinase activation by protecting dual-specificity phosphatases and suppressing MEK1/2. PMID: 12748284
  27. Associates with the I kappa B kinase complex regulates tumor necrosis factor alpha-induced NF-kappa B activation. PMID: 12829720
  28. down regulation in neuronal and non-neuronal cells expressing mutant ataxin-3 PMID: 12832059
  29. HSP27 is a ubiquitin-binding protein involved in I-kappaBalpha proteasomal degradation PMID: 12897149
  30. Phosphorylated HSP27 favors reduced bead motions that are probably due to stabilization of the actin cytoskeleton. PMID: 14729728
  31. HSP27 may provide a neuroprotective effect in AD and other tauopathies PMID: 14963027
  32. positive effect of Id-1 on TGF-beta1-induced cell motility was mediated through activation of MEK-ERK signaling pathway and subsequent phosphorylation of HSP27 PMID: 17916352
  33. a cellular defense against dysregulated proteins, in the form of Hsp27 and alphaB-crystallin, might contribute to the cell cycle reentry seen in AD cells. PMID: 18061943
  34. These data show that Hsp27 antagonizes Bax-mediated mitochondrial injury and apoptosis by promoting Akt activation via a PI3-kinase-dependent mechanism. PMID: 18299320
  35. Upon heating at 43 degrees C, Hsp27 effectively suppresses myosin subfragment 1 aggregation, and this effect is enhanced by mutations mimicking Hsp27 phosphorylation. PMID: 18387368
  36. In a large cohort of type 1 diabetic subjects, we found an independent association between serum HSP27 and distal symmetrical polyneuropathy. PMID: 18390793
  37. These findings identify a novel pathway for vascular endothelial growth factor-induced HSP27 serine 82 phosphorylation via PKC-mediated PKD activation and direct phosphorylation of HSP27 by PKD. PMID: 18440775
  38. HSP27 phosphorylation is correlated with ADP-induced platelet granule secretion. PMID: 18471985
  39. annexin II is a novel HSP27-interacted protein which is involved in UVC resistance in human cells PMID: 18494762
  40. Mechanistic in vitro studies showed upregulated HSP27 expression and secretion in human macrophages treated with estrogen or acLDL. PMID: 18566345
  41. In conclusion, despite the protective action against acute motor neuron injury, Hsp27 alone is not sufficient to protect against the chronic motor neuron injury due to the presence of mutant SOD1. PMID: 18624915
  42. Pint mutations in patients with type 2 diabetes and their families were studied. mitochondrial genes including np3316, np3394 and np3426 in the ND1 region and np3243 in the tRNA(Leu(UUR))were screened. PMID: 18701018
  43. Overexpression of HSP27 in squamous cell carcinoma of the uterine cervix: a proteomic analysis using archival formalin-fixed, paraffin-embedded issues is reported. PMID: 18755499
  44. HSP27 and HSP60 are predictors of biochemical recurrence of prostate cancer after radical prostatectomy. PMID: 19132982
  45. show that Hsp27 and actin are in the same complex in cells and that Hsp27 is important for cell motility. PMID: 19224398
  46. the differential expression patterns of alphaB-crystallin and Hsp27 indicate functional differences between these highly related proteins in placental tissues. PMID: 19238749
  47. data show islet protection in mice by human HSP27 by mitigation of apoptosis, possibly through nuclear factor kappaB regulation. PMID: 19325007
  48. Findings revealed a possible effect of HSP27 on apoptosis in metastatic HCC cells, in which HSP27 may regulate NF-kB pathway activation. PMID: 19331697
  49. findings provide the first evidence that expanded ataxin-3 interferes with Hsp27 synthesis, which may contribute to the impairment of the cells' ability to respond to stresses and trigger the progression of Machado-Joseph disease PMID: 19429074
  50. Overexpression of huHSP27 protects against hepatic injury and acute kidney injury associated with liver ischemia-reperfusion injury in mice. PMID: 19656912

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Note=Localizes to nuclear foci.
Protein Families
Small heat shock protein (HSP20) family
Tissue Specificity
Expressed preferentially in skeletal muscle and heart but not in the lens.
Database Links

HGNC: 5247

OMIM: 602179

KEGG: hsa:3316

STRING: 9606.ENSP00000457706

UniGene: Hs.709660

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*