Recombinant Human Hemoglobin subunit zeta(HBZ)

Code CSB-EP010162HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names HBZ
Uniprot No. P02008
Research Area Cardiovascular
Alternative Names HBAZ; HBAZ_HUMAN; HBZ 2; HBZ; HBZ2; Hemoglobin subunit zeta; Hemoglobin zeta; Hemoglobin zeta chain; Zeta globin; Zeta-globin
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-142aa
Target Protein Sequence SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 42.5kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Gene References into Functions
  1. Data indicate a tetranucleotide 3'UTR motif that is required for the high-level accumulation of zeta-globin transcripts in cultured cells, and demonstrate that it prolongs their cytoplasmic half-lives. PMID: 24751163
  2. Chimeric zeta globin exhibits oxygen binding characteristics which fall within the range observed in adult human and human embryonic hemoglobins. PMID: 11747442
  3. The HBZ protein is localized to heterochromatin and capable of repressing JUN activity and viral transcription. PMID: 15755797
Protein Families Globin family
Tissue Specificity Detected in fetal erythrocytes (at protein level).
Database Links

HGNC: 4835

OMIM: 142310

KEGG: hsa:3050

STRING: 9606.ENSP00000252951

UniGene: Hs.585357

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1