Recombinant Human Hemoglobin subunit zeta(HBZ)

Code CSB-EP010162HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P02008
Relevance The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias HBAZ Hemoglobin zeta chain Zeta-globin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Research Area Cardiovascular
Source E.coli
Gene Names HBZ
Protein Names Recommended name: Hemoglobin subunit zeta Alternative name(s): HBAZ Hemoglobin zeta chain Zeta-globin
Expression Region 1-142aa
Tag Info N-terminal GST-tagged
Mol. Weight 42.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Protein Families Globin family
Tissue Specificity Detected in fetal erythrocytes (at protein level).
Database Links

HGNC: 4835

OMIM: 142310

KEGG: hsa:3050

STRING: 9606.ENSP00000252951

UniGene: Hs.585357

Related Products

HBZ Antibodies

HBZ Antibodies for Homo sapiens (Human)

HBZ Antibodies for Human

HBZ Proteins

HBZ Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.