Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial

Code CSB-YP008533HU1
Product Type Recombinant Protein
Size US$2010
Uniprot No. P30273
Relevance Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Research Area Immunology
Source Yeast
Gene Names FCER1G
Protein Names Recommended name: High affinity immunoglobulin epsilon receptor subunit gammaAlternative name(s): Fc receptor gamma-chain Short name= FcRgamma Fc-epsilon RI-gamma IgE Fc receptor subunit gamma Short name= FceRI gamma
Expression Region 45-86aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 6.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families CD3Z/FCER1G family
Database Links

HGNC: 3611

OMIM: 147139

KEGG: hsa:2207

STRING: 9606.ENSP00000289902

UniGene: Hs.433300

Pathway Fc epsilon RI signaling pathway
Natural killer cell mediated cytotoxicity
Oxidative Phosphorylation
Phospholipase D signaling pathway
Sphingolipid signaling pathway

Related Products

FCER1G Antibodies

FCER1G Antibodies for Human

FCER1G Proteins

FCER1G Proteins for Homo sapiens (Human)

FCER1G ELISA Kit

FCER1G ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.