Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma(FCER1G),partial

Code CSB-YP008533HU1
Size US$2010
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names FCER1G
Uniprot No. P30273
Research Area Immunology
Alternative Names Fc fragment of IgE; high affinity I; receptor for; gamma polypeptide; Fc receptor gamma chain; Fc-epsilon RI-gamma; FCER1G; FCERG_HUMAN; FceRI gamma; FCRG; FcRgamma; High affinity immunoglobulin epsilon receptor subunit gamma; IgE Fc receptor subunit gamma; Immunoglobulin E receptor; high affinity; gamma chain
Species Homo sapiens (Human)
Source Yeast
Expression Region 45-86aa
Target Protein Sequence RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 6.9kDa
Protein Length Cytoplasmic Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Gene References into Functions
  1. FCER1G was identified and validated in association with ccRCC progression and prognosis, which might improve the prognosis by influencing immune-related pathways PMID: 29209141
  2. mass spectrometry of WT human FcRgamma from receptor-stimulated cells shows consistent preferential phosphorylation of the serine residue at position 51. PMID: 27630214
  3. FcgammaR-mediated Syk activation leads to NLRP3 inflammasome-dependent IL-1beta production in macrophages and suggests that an Nlrp3- and IL-1R-dependent process contributes to the IgA response important for protection against Francisella tularensis LVS. PMID: 27365531
  4. Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression. PMID: 25513989
  5. Studies indicate that in response to stimulation with antigen, PHB1 translocated to plasma membrane lipid rafts to form a ternary complex with the high-affinity IgE receptor FcepsilonRIgamma and the nonreceptor tyrosine kinase Syk. PMID: 24023253
  6. High expression of FCER1G is associated with chronic myeloid leukemia. PMID: 23228155
  7. There was loss of the negative correlation in the expression levels of CD3eta and FcepsilonRIgamma genes in CLL patients. PMID: 22664044
  8. CD2-associated adaptor protein (CD2AP) positively regulates blood dendritic cell antigen 2 (BDCA2)/FcepsilonR1gamma signaling by forming a complex with SH2 domain-containing inositol 5'-phosphatase (SHIP)1 to inhibit the E3 ubiquitin ligase Cbl. PMID: 22706086
  9. Altered expression of the TCR signaling related genes CD3 and FcepsilonRIgamma in patients with aplastic anemia. PMID: 22401598
  10. Conservation of FcepsilonRI gamma chain coding region in normals and in SLE patients. PMID: 11898918
  11. FCGR3B quantification confirms the idea of the HNA-1c antigen to be inherited not only linked to HNA-1a, but also to be passed down on its own. PMID: 12366784
  12. Overexpression of the Fc epsilon RI gamma chain in normal T cells associates with TCR/CD3 complex, contributes to altered T cell signaling, and down-regulates the endogenous TCR zeta-chain expression in human T cells. PMID: 12626537
  13. evidence that FcepsilonRI-gamma (gamma) associates with 2DL4 to promote surface expression and provide signal transducing function. PMID: 15778339
  14. Data suggest that by associating with Fc epsilon RI gamma, BDCA2 activates a novel BCR-like signaling pathway to regulate the immune functions of plasmacytoid dendritic cells. PMID: 17850179
  15. The activating functions of KIR2DL4 killer receptor in natural killer (NK) cells are compartmentalized into distinct structural modules through transmembrane association with the Fc epsilon RI-gamma (FCERIG) receptor. PMID: 18292514
  16. Elf-1 in combination with Sp1 and GABP reduced FcRgamma promoter activity. PMID: 18378679
  17. reduced expression in histamin non-releaser basophils PMID: 19362683

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families CD3Z/FCER1G family
Database Links

HGNC: 3611

OMIM: 147139

KEGG: hsa:2207

STRING: 9606.ENSP00000289902

UniGene: Hs.433300

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1