Recombinant Human Histamine H4 receptor (HRH4), partial

Code CSB-EP887972HU1a0
Abbreviation Recombinant Human HRH4 protein, partial
MSDS
Size $256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
AXOR35;G-protein coupled receptor 105;GPRv53;Pfi-013;SP9144
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
194-304aa
Target Protein Sequence
NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The H4 subclass of histamine receptors could mediate the histamine signals in peripheral tissues. Displays a significant level of constitutive activity (spontaneous activity in the absence of agonist).
Gene References into Functions
  1. these findings reveal that rs11662595 is a loss-of-function polymorphism that results in dysfunction of HRH4 and attenuates the anti-epithelial-to-mesenchymal transition function of HRH4 in non-small cell lung cancer (NSCLC), which provides a promising biomarker for prognosis and therapy of NSCLC. PMID: 28847511
  2. Taken together, the silencing of H4R inhibited the H4R mediated Mast cell functions and SAPK/JNK phosphorylation. Furthermore, the H4R activation utilized SAPK/JNK signaling pathway for IL-1beta release in HMC-1 cells PMID: 29863427
  3. Our novel scientific data provide further indication that histamine, in particular via the H4R, plays a potent role in the pathophysiology of allergic diseases through tight control of Th1-Th2 mediator production favoring Th2 lymphocyte accumulation in inflamed tissues. Our results add to a growing evidence of data suggesting that the H4R may serve as a therapeutic target in allergic diseases. PMID: 29600327
  4. The expression of H4R was increased in peripheral blood monocytes in rheumatoid arthritis patients. Histamine and Th17 cytokines induced the osteoclast differentiation from monocytes and JNJ7777120 decreased the osteoclastogenesis. PMID: 28446753
  5. H1R and H4R are useful biomarkers of allergic inflammation on the ocular surface. Most notably, H4R expressed on eosinophils is useful as a biomarker of eosinophilic inflammation of the ocular surface. PMID: 28391980
  6. Histamine stimulation influences the IL-17 pathway in psoriasis via the fourth histamine receptor subtype, H4R, on CD4+ T cells. PMID: 28592369
  7. This study suggests that genetic variations within the HRH4 gene might be associated with special clinical features of psoriasis. PMID: 27725312
  8. Our findings provide evidence that HRH4 rs77485247 and rs77041280 polymorphisms may be associated with the risk of allergic rhinitis (AR) and the efficacy of H1 antihistamines for the treatment of AR patients. PMID: 27888642
  9. These data imply that the H4R regulates IgE-dependent processes in human basophils and provides a novel function of the H4R preventing an overwhelming immune reaction by engagement of a negative feedback loop. PMID: 26948974
  10. Pharmacological or genetic modulations of H2 and H4 HRs (H2R and H4R) not only suppressed gefitinib-induced cytostasis and differentiation of AML cells but also blocked EGFR and ERK1/2 inhibition in MDA-MB-231 cells PMID: 27180173
  11. Histamine H4 receptors could not be identified in five experimental models of the guinea-pig that are suited for the detection of presynaptic inhibitory receptors (hippocampus aorta, atrium, renal cortex and vas deferens) whereas H3 receptors could be shown in the peripheral tissues but not in the hippocampus PMID: 26211976
  12. Taken together these data demonstrate that compound A and compound L may block H4R-mediated downstream signaling events. PMID: 27807993
  13. We also found that the activation of H4R caused the release of IL-13 and RANTES on human mast cells.these data demonstrate that the H4R activates divergent signaling pathways to induce cytokine and chemokine production in human mast cells PMID: 27400655
  14. H4R may be involved in the maintenance of healthy oral mucosa. In oral lichen planus, this maintenance might be impaired by mast cell degranulation and inflammatory cytokines. PMID: 25207698
  15. Activation of the H4R could induce phosphorylation of ERK. PMID: 26828993
  16. Suggest roles for HRH4 polymorphisms and ankylosing spondylitis susceptibility. PMID: 26823878
  17. H4 receptor expression plays a role in pathological vessel leakage associated with choroidal neovascularization PMID: 24787705
  18. Molecular modelling studies, including molecular dynamic simulations and calculation of Gibbs energy of solvation of hH3R and hH4R, were studied. PMID: 25098339
  19. Functional H4 receptors increasing (35)S-GTPgammaS binding and/or decreasing noradrenaline release are not found in human, guinea pig or mouse cortex PMID: 25300787
  20. HRH4 was increased in clinically-isolated syndrome and different stages of multiple sclerosis compared to health control. PMID: 25293806
  21. No evidence was found for the presence of histamine H4 receptor in monocytes. PMID: 25273276
  22. In neutrophils, the H4 receptor may block signals emanating from Mac-1-controlling degranulation. Engagement of the H4 receptor by selective agonists blocked Mac-1-dependent activation of p38 MAPK. PMID: 24799603
  23. The activation of H4R in human mast cells produced not only inflammatory mediators that are associated with allergic reactions but also other inflammatory conditions. PMID: 24934979
  24. Increased expression of the H4 receptor was observed in HaCaT cells following differentiation. PMID: 24372819
  25. Histamine through the histamine H4 receptor exhibits a crucial role in breast tumour progression. PMID: 23425150
  26. Obtained results allow for statement that developed cellular model may be successfully employed in search for new compounds active at histamine H4 receptor PMID: 24432340
  27. Methyl substitution in histamine homologs offers a way to shift the selectivity in favor of the H4R. PMID: 24493592
  28. But carriers of one or three copies of HRH1 (5% of individuals), HRH2 (1.1%) and HRH4 genes (0.9%) were also identified. PMID: 24236486
  29. Data show down-regulation of cyclic adenosine monophosphate (cAMP) was the secondary signalling after H4 receptor activation, which in turn resulting in inactivation of transforming growth factor-beta1(TGF-beta1) pathway. PMID: 24447834
  30. The inhibitory effects of histamine on reactive oxygen species production in whole blood phagocytes are caused by H2R rather than H4R histamine receptors. PMID: 24530738
  31. H4R is highly expressed on keratinocytes from patients with atopic dermatitis, and its stimulation induces keratinocyte proliferation. PMID: 23932072
  32. In this review, we focus on the role of histamine and its receptors in the treatment of Alzheimer's disease. PMID: 23677734
  33. Copy number variationss of the HRH4 gene are associated with atopic dermatitis in a Chinese population. PMID: 23517361
  34. Histamine receptor-4-mRNA expression showed a significant increase in caudate nucleus and putamen in Parkinson's disease patients. PMID: 22118942
  35. Genotypes of HRH4 gene are signi fi cantly associated with the risk and malignant degree of breast cancer in Chinese Han populations. PMID: 23481304
  36. The efficacy of 31 known hHR ligands to induce Galpha(i) protein signaling and beta-arrestin2 recruitment by the hHR. PMID: 22973061
  37. Report down-regulation of HRH4 mRNA in synovial tissue from rheumatoid arthritis patients compared to those with osteoarthritis. PMID: 21881994
  38. Twenty-one SNPs of the HRH4 gene were genotyped in 313 asthmatic patients and 360 controls. Genotype distribution of three SNPs rs17187619, rs527790 and rs487202 differed significantly between patients with or without infection-induced asthma. PMID: 22653292
  39. study identified novel functional properties in terms of voltage sensitivities and deactivation rates, which differed between the histamine hH3445, hH3365, and H4 receptors PMID: 22885137
  40. analysis of fragment optimization and analysis of binding kinetics for ligand based design of novel histamine H receptor antagonists PMID: 22153663
  41. Deletion of HRH4 gene is present in gastric cancer cases and is closely correlated with attenuated gene expression. PMID: 22363581
  42. fundamental concepts of HR structure modeling and its implementation in drug discovery (review) PMID: 22201741
  43. histamine H(4) receptor as an attractive target in the treatment of inflammatory and autoimmune disorders PMID: 21741967
  44. Histamine H4 receptors were found in normal nasal mucosa, and increased significantly in nasal mucosa of allergic rhinitis patients. PMID: 21171298
  45. our results indicate that the H(4)R is highly expressed on plasmacytoid dendritic cells in psoriasis and influences cytokine production and migration of these cells PMID: 21614010
  46. These findings suggested a potential role of abnormal HRH4 expression in the progression of CRCs PMID: 21609450
  47. we describe a possible genetic impact on the expression level of the histamine H4 receptor and summarize the current data regarding the activity of the histamine H4 receptor on the key effector cells in atopic dermatitis PMID: 21104170
  48. slan-dendritic cells (slanDC) express the H(4) R and its stimulation leads to reduced pro-inflammatory capacity of slanDC PMID: 20722760
  49. Copy number variations of the human histamine H4 receptor gene are associated with systemic lupus erythematosus PMID: 20618322
  50. Langerhans cells express a functional H(4)R and point towards a possible pathogenic relevance of the H(4)R in inflammatory and allergic diseases. PMID: 19958313

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed primarily in the bone marrow and eosinophils. Shows preferential distribution in cells of immunological relevance such as T-cells, dendritic cells, monocytes, mast cells, neutrophils. Also expressed in a wide variety of peripheral tissues, inclu
Database Links

HGNC: 17383

OMIM: 606792

KEGG: hsa:59340

STRING: 9606.ENSP00000256906

UniGene: Hs.287388

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*