Recombinant Human Histone H1.0(H1F0)

Code CSB-EP010087HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P07305
Relevance Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Histone H1' Histone H1(0)
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names H1F0
Protein Names Recommended name: Histone H1.0 Alternative name(s): Histone H1' Histone H1(0)
Expression Region 1-194aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
Subcellular Location Nucleus, Chromosome
Protein Families Histone H1/H5 family
Database Links

HGNC: 4714

OMIM: 142708

KEGG: hsa:3005

STRING: 9606.ENSP00000344504

UniGene: Hs.745024

Related Products

H1F0 Antibodies

H1F0 Antibodies for Homo sapiens (Human)

H1F0 Antibodies for Human

H1F0 Proteins

H1F0 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.