Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Transcription
Alternative Names
HD3; HDAC 3; HDAC3; HDAC3_HUMAN; Histone deacetylase 3; RPD3 2; RPD3; RPD3-2; SMAP45
Species
Homo sapiens (Human)
Expression Region
1-428aa
Target Protein Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-428 constitute the expression domain of recombinant Human HDAC3. This HDAC3 protein is expected to have a theoretical molecular weight of 64.8 kDa. Expression of this HDAC3 protein is conducted in e.coli. The HDAC3 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant HDAC3 protein during the following stages.
Histone deacetylase 3 (HDAC3) is a crucial enzyme involved in epigenetic regulation by catalyzing the removal of acetyl groups from histone proteins. As part of the histone deacetylase family, HDAC3 plays a key role in controlling gene expression and chromatin structure. It is essential for various cellular processes, including cell cycle progression, differentiation, and apoptosis. HDAC3 is often found in multi-protein complexes and is implicated in the regulation of diverse biological pathways. Dysregulation of HDAC3 has been associated with several diseases, including cancer and neurological disorders. Targeting HDAC3 has become a focus in drug development for potential therapeutic interventions, making it a subject of interest in both basic research and clinical studies.