Home
Protein
Recombinant Proteins
Recombinant Human Histone deacetylase 7 (HDAC7), partial

Recombinant Human Histone deacetylase 7 (HDAC7), partial

^{In Stock}

Code	CSB-EP010243HU1(F5)
Abbreviation	Recombinant Human HDAC7 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

HDAC7

Uniprot No.

Q8WUI4-7

Research Area

Transcription

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

4-203aa

Target Protein Sequence

PGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26kDa

Protein Length

Partial of Isoform 7

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In e.coli cells, the generation of recombinant Human HDAC7 protein involves cloning a DNA fragment encoding the Human HDAC7 protein (4-203aa) into a plasmid vector, which is then transferred into the e.coli cells. Positive cells are selected, cultured, and induced to express the HDAC7 protein. A N-terminal 6xHis tag is attached to the protein. Lysis of the cells allows for the harvest of the recombinant Human HDAC7 protein. The collected recombiant Human HDAC7 protein is subjected to affinity purification and is identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. Its purity is greater than 90%.