Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

MEIS3

Uniprot No.

Q99687

Research Area

Transcription

Alternative Names

Meis1-related protein 2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-375aa

Target Protein Sequence

MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

48.6 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-375 constitute the expression domain of recombinant Human MEIS3. The expected molecular weight for the MEIS3 protein is calculated to be 48.6 kDa. This protein is generated in a e.coli-based system. The MEIS3 gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant MEIS3 protein during the following stages.

The human homeobox protein Meis3 (MEIS3) belongs to the TALE (Three-Amino Acid Loop Extension) superclass of homeodomain transcription factors. MEIS3 is involved in embryonic development, where it plays a crucial role in specifying cell fate and pattern formation. It participates in the development of various tissues and organs, including the brain, heart, and hematopoietic system. MEIS3 is known to interact with other transcription factors and co-factors to regulate gene expression, influencing processes such as cell proliferation, differentiation, and organogenesis. Additionally, MEIS3 has been implicated in certain cancers, highlighting its significance in both normal development and pathological conditions.

Target Background

Function

Transcriptional regulator which directly modulates PDPK1 expression, thus promoting survival of pancreatic beta-cells. Also regulates expression of NDFIP1, BNIP3, and CCNG1.

Gene References into Functions

Findings support a model in which Meis3 is required for neural crest proliferation, migration into, and colonization of the gut such that its loss leads to severe defects in enteric nervous system development. PMID: 26354419
This work suggests that the transcriptional activity of all members of the Meis/Prep Hth protein family is subject to autoinhibition by their Hth domains, and that the Meis3.2 splice variant encodes a protein that bypasses this autoinhibitory effect. PMID: 20553494

Subcellular Location

Nucleus.

Protein Families

TALE/MEIS homeobox family

Database Links

HGNC: 29537

KEGG: hsa:56917

UniGene: Hs.356135

Code	CSB-EP859938HU
Abbreviation	Recombinant Human MEIS3 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Homeobox protein Meis3 (MEIS3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage