Recombinant Human Hyaluronidase-1 (HYAL1), partial

In Stock
Code CSB-EP623651HU1e3
Abbreviation Recombinant Human HYAL1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
HYAL1
Uniprot No.
Research Area
Cancer
Alternative Names
Hyal-1;Hyaluronoglucosaminidase-1;Lung carcinoma protein 1;LuCa-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
273-435aa
Target Protein Sequence
AVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Gene References into Functions
  1. Data revealed a significant inverse correlation between ERalpha and HYAL1 gene expression in human breast tumors. HYAL1 was found repressed by estrogen through ERalpha binding to a consensus response element (ERE) located in the proximal promoter of HYAL1 and flanked by an Sp1 binding site, required to achieve optimal estrogen repression. PMID: 27764788
  2. Ureaplasma urealyticum infection may affect the activity of hyaluronidase on spermatozoa PMID: 28012250
  3. our results suggest that the enzyme HYAL1 plays a role in tumor dissemination and brain-specific colonization, rather than in subsequent metastatic out-growth. PMID: 28168629
  4. HAS2 and HAS3 were the only hyaluronan synthases detected, the expression of which was almost similar in NPs and NM. PMID: 26661071
  5. Molecular docking simulation explains the less favorable binding energy of substrate towards mutant E268K, thereby providing a structural basis for its reduced catalytic activity. PMID: 27424109
  6. The receiver-operating characteristic curve analyses demonstrated that each one had good sensitivity and specificity for distinguishing BC patients from non-BC ones (HYAL1, miR-210, miR-96, lncRNA-UCA1, 91.5 and ). PMID: 26138586
  7. Study showed that reduced HYAL1 expression was associated with endometrial carcinoma aggressiveness, which further supported the role of hyaluronan degradation in cancer progression. PMID: 25584766
  8. Results demonstrated that HYAL1 was C-mannosylated and suggest the possible role of C-mannosylation for secretion and enzymatic activity of HYAL1. PMID: 24820161
  9. In contrast to the previously described MPS IX patient, our three patients display a phenotype limited to the joints, suggesting that this is the primary manifestation of HYAL1 deficiency. PMID: 21559944
  10. Upregulation of HYAL1 expression in breast cancer promoted tumor cell proliferation, migration, invasion and angiogenesis. PMID: 21829529
  11. This is the first report showing high HYAL-1 levels in epithelial ovarian cancer. PMID: 21695196
  12. HYAL-1 and HAS1 expression predicted BCa metastasis, and HYAL-1 expression also predicted disease-specific survival. PMID: 20960509
  13. HYAL1 overexpression is correlated with the malignant behavior of breast cancer. PMID: 20473947
  14. Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma PMID: 20875124
  15. Overexpression of HYAL1 is associated with colorectal cancer. PMID: 20849597
  16. The protein products HABP2 and HYAL1 were associated with plasma PAI-1 concentration and play key roles in hyaluronan metabolism, providing genetic evidence to link these pathways. PMID: 20558613
  17. rhHyal-1 is endocytosed by the liver. PMID: 20572808
  18. HYAL-1 is a potential prognostic marker for predicting progression to muscle invasion and recurrence in bladder cancer. PMID: 19345473
  19. Data show that a significant in expression levels of HA synthases (HASs) and hyaluronidases (Hyals) was observed in vitro on stimulation of epithelial ovarian carcinoma cells by gonadotropins. PMID: 20072653
  20. Characterization of the murine hyaluronidase gene region reveals complex organization and cotranscription of Hyal1 with downstream genes, Fus2 and Hyal3. PMID: 11929860
  21. Alternative mRNA splicing controls cellular expression of enzymatically active hyaluronidase. PMID: 12084718
  22. Down-regulation of HYAL1 is associated with small cell lung cancer and glioma PMID: 12684632
  23. Increased expression of hyaluronidase is associated with head and neck tumors PMID: 12845686
  24. Hyaluronidase and CD44 hyaluronan receptor are expressed in squamous cell laryngeal carcinoma PMID: 16713680
  25. Gene silencing of HYAL1 inhibited cell proliferation and induced cell cycle arrest in human breast cancer cells. PMID: 16831275
  26. HYAL1-v1 transfectants grew 3- to 4-fold slower due to cell cycle arrest in the G(2)-M phase and increased apoptosis. PMID: 17145867
  27. Purified recombinant Hyal-1 from Drosophila cells was used for the investigation of the inhibitory activity of new ascorbic acid derivatives PMID: 17227790
  28. further support to altered glycosaminoglycan metabolism (hyaluronan and hyaluronidase blood levels)in type 1 diabetes as a potential mechanism involved in accelerated atherogenesis. PMID: 17415544
  29. hyaluronan processing by elevated HYAL1 expression in invasive prostate cancer is a requirement for progression. PMID: 17502371
  30. crystal structure reveals a molecule composed of two closely associated domains: a catalytic domain that adopts a distorted (beta/alpha)8 barrel resembling that of bee venom hyaluronidase, and a novel, EGF-like domain PMID: 17503783
  31. Hyaluronidase activity is modulated by complexing with various polyelectrolytes including hyaluronan PMID: 18083358
  32. The expression of HYAL1 in ductal hyperplastic tissues is a strong predictor of subsequent development of invasive breast cancer PMID: 18281563
  33. Bovine serum albumin competes with human hyalurinodase and thus increases hyaluronidase release resulting in a large increase in the hydrolysis rate. PMID: 18677769
  34. HYAL-1 expression is epigenetically regulated by the binding of different transcription factors to the methylated and unmethylated HYAL-1 promoter PMID: 18718911
  35. Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer PMID: 19140316
  36. define key components of Hyal1 active site catalysis, and structural factors critical for stability PMID: 19201751
  37. HYAL1, but not HYAL2, expression is reduced and correlates with the accumulation of hyaluronan in ovarian carcinomas. PMID: 19435493
  38. Data showed that the HYAL1 variant exhibited hyaluronan degradation at elevated pH. PMID: 19478093
  39. Invasive features of ER(-) breast cancer cells can be characterized in vitro by higher secretion of hyaluronidase, higher expression of proteinases MMP-9, cath-D, and the angiogenesis promoting factor VEGF. PMID: 19567141

Show More

Hide All

Involvement in disease
Mucopolysaccharidosis 9 (MPS9)
Subcellular Location
Secreted. Lysosome.
Protein Families
Glycosyl hydrolase 56 family
Tissue Specificity
Highly expressed in the liver, kidney and heart. Weakly expressed in lung, placenta and skeletal muscle. No expression detected in adult brain. Isoform 1 is expressed only in bladder and prostate cancer cells, G2/G3 bladder tumor tissues and lymph node sp
Database Links

HGNC: 5320

OMIM: 601492

KEGG: hsa:3373

STRING: 9606.ENSP00000266031

UniGene: Hs.75619

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*