Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IFNE

Uniprot No.

Q86WN2

Research Area

Immunology

Alternative Names

IFNE; IFNE1; UNQ360/PRO655; Interferon epsilon; IFN-epsilon; Interferon epsilon-1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-208aa

Target Protein Sequence

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant human IFNE protein is encoded by a recombinant DNA that was cloned into the expression vector and then transformed into the E.coli that supports the expression of the gene. The recombinant DNA was constructed by fusing the N-terminal 6xHis tag gene to the gene fragment coding for the 22-208aa of the human IFNE protein. After purification, the product is the recombinant human IFNE protein. This recombinant IFNE protein was subjected to the SDS-PAGE determination. Its purity reaches over 90% evaluated by Bandscan software analysis combined with SAS-PAGE. This IFNE protein ran to the molecular weight of about 28 kDa under SDS-PAGE condition. It may have applications in immunology research.

IFNE belongs to the alpha/beta interferon family. Interferon epsilon-1 (IFNE) is mainly found in endometrial epithelial cells. Interferon epsilon-1 has been found to be related to pathway RIG-I/MDA5. IFNE directly mediates protection against viral and bacterial genital infections. Further researches suggested that IFNE could prevent HIV infection in macrophages through a type I IFN independent mechanism. Certain findings suggested that the pathway dysregulation was consistent with SARS-CoV-2 infection of an organism lacking IFNE.

Target Background

Function

Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections.

Gene References into Functions

IFN epsilon protects macrophages against HIV infection through a type I IFN independent mechanism. PMID: 27942584
human IFNvarepsilon suppresses HIV replication at multiple stages of infection. PMID: 28045025
female sex workers decreased susceptibility to HIV-1 infection also have increased levels of IFNE gene and protein expression in the cervical epithelium PMID: 26555708
T Allele of nonsense polymorphism (rs2039381, Gln71Stop) of interferon-epsilon is a risk factor for the development of intracerebral hemorrhage. PMID: 24055696
Full-length IFN-epsilon 5'UTR markedly suppressed mRNA expression under basal conditions. It contains 2 stable stem-loop structures which associate with importin 9. Loop 1 is essential for regulation of mRNA expression. PMID: 23851686
genetic polymorphism is related to onset time of vitiligo in Korean patients PMID: 23802172
Observational study of gene-disease association. (HuGE Navigator) PMID: 20574843
Observational study of gene-disease association. (HuGE Navigator) PMID: 20588308
Observational study of gene-disease association. (HuGE Navigator) PMID: 20601674
The structue and mRNA expression pattern of IFN-epsilon1 suggest that it may have a function distinct from those other members of type I INF. PMID: 15233997
TNF-alpha leads to stabilization of IFN-epsilon mRNA, increased IFN-epsilon synthesis, engagement of type I IFNRs, increased STAT1 expression and phosphorylation, and up-regulation of retinoic acid-inducible gene-I expression PMID: 17878351
A meta-analysis and a single-nucleotide polymorphism (SNP) rs1333049 representing the 9p21.3 locus provide unprecedented evidence for association between genetic variants at chromosome 9p21.3 and risk of coronary artery disease. PMID: 18362232
In macrophages IFN-tau increased the synthesis of 2',5'-oligoadenylate synthetase/RNase L, MxA protein, IL-10 & IL-6, but not of IL-1ss or TNF-alpha. PMID: 18842358

Hide All

Subcellular Location

Secreted.

Protein Families

Alpha/beta interferon family

Tissue Specificity

Endometrium-specific.

Database Links

HGNC: 18163

OMIM: 615223

KEGG: hsa:338376

STRING: 9606.ENSP00000418018

UniGene: Hs.682604

Code	CSB-EP803137HU
Abbreviation	Recombinant Human IFNE protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interferon epsilon (IFNE)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage