Recombinant Human Interferon epsilon(IFNE)

In Stock
Code CSB-EP803137HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q86WN2
Lead Time 3-7 business days
Relevance Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral and bacterial genital infections .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interferon epsilon-1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Research Area Immunology
Source E.coli
Gene Names IFNE
Expression Region 22-208aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 26.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections (By similarity).
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Tissue Specificity Endometrium-specific.
Database Links

HGNC: 18163

OMIM: 615223

KEGG: hsa:338376

STRING: 9606.ENSP00000418018

UniGene: Hs.682604

Pathway Jak-STAT signaling pathway

Related Products

IFNE Antibodies

IFNE Antibodies for Homo sapiens (Human)

IFNE Proteins

IFNE Proteins for Homo sapiens (Human)

IFNE ELISA Kit

IFNE ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.