Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
IFNE; IFNE1; UNQ360/PRO655; Interferon epsilon; IFN-epsilon; Interferon epsilon-1
Species
Homo sapiens (Human)
Expression Region
22-208aa
Target Protein Sequence
LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human IFNE protein is encoded by a recombinant DNA that was cloned into the expression vector and then transformed into the E.coli that supports the expression of the gene. The recombinant DNA was constructed by fusing the N-terminal 6xHis tag gene to the gene fragment coding for the 22-208aa of the human IFNE protein. After purification, the product is the recombinant human IFNE protein. This recombinant IFNE protein was subjected to the SDS-PAGE determination. Its purity reaches over 90% evaluated by Bandscan software analysis combined with SAS-PAGE. This IFNE protein ran to the molecular weight of about 28 kDa under SDS-PAGE condition. It may have applications in immunology research.
IFNE belongs to the alpha/beta interferon family. Interferon epsilon-1 (IFNE) is mainly found in endometrial epithelial cells. Interferon epsilon-1 has been found to be related to pathway RIG-I/MDA5. IFNE directly mediates protection against viral and bacterial genital infections. Further researches suggested that IFNE could prevent HIV infection in macrophages through a type I IFN independent mechanism. Certain findings suggested that the pathway dysregulation was consistent with SARS-CoV-2 infection of an organism lacking IFNE.
