Recombinant Human Interferon epsilon (IFNE)

In Stock
Code CSB-EP803137HU
Abbreviation Recombinant Human IFNE protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IFNE; IFNE1; UNQ360/PRO655; Interferon epsilon; IFN-epsilon; Interferon epsilon-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-208aa
Target Protein Sequence
LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human IFNE protein is encoded by a recombinant DNA that was cloned into the expression vector and then transformed into the E.coli that supports the expression of the gene. The recombinant DNA was constructed by fusing the N-terminal 6xHis tag gene to the gene fragment coding for the 22-208aa of the human IFNE protein. After purification, the product is the recombinant human IFNE protein. This recombinant IFNE protein was subjected to the SDS-PAGE determination. Its purity reaches over 90% evaluated by Bandscan software analysis combined with SAS-PAGE. This IFNE protein ran to the molecular weight of about 28 kDa under SDS-PAGE condition. It may have applications in immunology research.

IFNE belongs to the alpha/beta interferon family. Interferon epsilon-1 (IFNE) is mainly found in endometrial epithelial cells. Interferon epsilon-1 has been found to be related to pathway RIG-I/MDA5. IFNE directly mediates protection against viral and bacterial genital infections. Further researches suggested that IFNE could prevent HIV infection in macrophages through a type I IFN independent mechanism. Certain findings suggested that the pathway dysregulation was consistent with SARS-CoV-2 infection of an organism lacking IFNE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections.
Gene References into Functions
  1. IFN epsilon protects macrophages against HIV infection through a type I IFN independent mechanism. PMID: 27942584
  2. human IFNvarepsilon suppresses HIV replication at multiple stages of infection. PMID: 28045025
  3. female sex workers decreased susceptibility to HIV-1 infection also have increased levels of IFNE gene and protein expression in the cervical epithelium PMID: 26555708
  4. T Allele of nonsense polymorphism (rs2039381, Gln71Stop) of interferon-epsilon is a risk factor for the development of intracerebral hemorrhage. PMID: 24055696
  5. Full-length IFN-epsilon 5'UTR markedly suppressed mRNA expression under basal conditions. It contains 2 stable stem-loop structures which associate with importin 9. Loop 1 is essential for regulation of mRNA expression. PMID: 23851686
  6. genetic polymorphism is related to onset time of vitiligo in Korean patients PMID: 23802172
  7. Observational study of gene-disease association. (HuGE Navigator) PMID: 20574843
  8. Observational study of gene-disease association. (HuGE Navigator) PMID: 20588308
  9. Observational study of gene-disease association. (HuGE Navigator) PMID: 20601674
  10. The structue and mRNA expression pattern of IFN-epsilon1 suggest that it may have a function distinct from those other members of type I INF. PMID: 15233997
  11. TNF-alpha leads to stabilization of IFN-epsilon mRNA, increased IFN-epsilon synthesis, engagement of type I IFNRs, increased STAT1 expression and phosphorylation, and up-regulation of retinoic acid-inducible gene-I expression PMID: 17878351
  12. A meta-analysis and a single-nucleotide polymorphism (SNP) rs1333049 representing the 9p21.3 locus provide unprecedented evidence for association between genetic variants at chromosome 9p21.3 and risk of coronary artery disease. PMID: 18362232
  13. In macrophages IFN-tau increased the synthesis of 2',5'-oligoadenylate synthetase/RNase L, MxA protein, IL-10 & IL-6, but not of IL-1ss or TNF-alpha. PMID: 18842358

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha/beta interferon family
Tissue Specificity
Endometrium-specific.
Database Links

HGNC: 18163

OMIM: 615223

KEGG: hsa:338376

STRING: 9606.ENSP00000418018

UniGene: Hs.682604

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*