Recombinant Human Interferon lambda-4 (IFNL4)

Code CSB-YP128511HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP128511HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP128511HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP128511HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP128511HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
IFNL4
Uniprot No.
Alternative Names
Interferon lambda-4; IFN-lambda-4; IFNL4
Species
Homo sapiens (Human)
Expression Region
22-179
Target Protein Sequence
AAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that may trigger an antiviral response activating the JAK-STAT pathway and up-regulating specifically some interferon-stimulated genes.
Gene References into Functions
  1. These results demonstrate that virus-induced IFN-lambda4 potently blocks IFN-alpha signalling by inducing high protein levels of ISG15 and USP18. Moreover, the data clearly demonstrate that DAA therapy restores IFN-alpha responsiveness in HCV-infected cells. PMID: 28630501
  2. The results show that IFNL4 ss469415590 DeltaG/DeltaG genotype was associated with poor virological response to anti-hepatitis C combination therapy. PMID: 30480920
  3. Studied the association of interferon-lambda 4 (IFNL4)-related polymorphisms and human leukocyte antigen (HLA)-B haplotypes within long-term nonprogressor HIV-1 controllers (LTNP-Cs); HLA-B*57 was independently associated with the LTNP-C phenotype, while IFNL4 genotypes represented independent factors for becoming non-LTNP-C. PMID: 27986689
  4. IFNL4 genotype might predict DAA-response. PMID: 29866411
  5. our study validated that IFNL4 ss469415590 was also strongly associated with HCV clearance in Chinese Han population. PMID: 28186161
  6. IFN-lambda4 suppressed HIV infection of macrophages. This IFN-lambda4-mediated HIV inhibition was compromised by the antibodies against IFN-lambda receptor complex, IFN-lambdaR1/IL-10R2. PMID: 30247785
  7. Analysis of the IFNL4 polymorphism rs368234815 in association with human papillomavirus (HPV) results, does not suggest its possible role during low or high-risk with HPV infection or in determining HPV outcome (clearance/reinfection or persistence/high-grade lesion). PMID: 29243064
  8. Significant associations were observed for 4 variants in IFNAR2, IFNLR1 with hepatitis B virus infection, and IFNLR1-rs4649203 was associated with hepatitis B recovery. Moreover, the authors demonstrated the clear relevance of 5 polymorphisms in IFNA1, IFNA2, IFNL4 with hepatocellular carcinoma. PMID: 29080269
  9. It has been shown that age, spontaneous lymphocyte proliferation, and an IFNL4 polymorphism were associated with progression to HTLV-I-associated myelopathy-tropical spastic paraparesis. PMID: 29129607
  10. IFNL locus SNPs are subject to either a positive or a negative confounding effect by rs117648444. PMID: 28727946
  11. Intrahepatic expression of IFNL4 was associated with increased antiviral interferon-stimulated gene (ISG) expression and decreased suppressive ISG expression at baseline, resulting in poor responsiveness to IFNalpha-based therapy in HCV infection. PMID: 28036111
  12. The association between IFNL3/4 genotypes with elevated HCV VL observed in HCV g6-infected individuals may have implications for the progression of liver disease in Southeast Asian countries where this viral genotype predominates and therefore warrants further studies. PMID: 29022122
  13. Interferon lambda polymorphisms influence regulatory pathways of cellular response to interferon and affect body iron balance in chronic hepatitis C virus infection. PMID: 27125837
  14. Studied involvement of two interferon lambda 4 (IFNL4) single nucleotide polymorphisms in predicting sustained virologic response (SVR) following antiviral therapy in patients with inherited bleeding disorder and chronic hepatitis C. PMID: 27735085
  15. these results suggest unique functional properties of IFN-lambda4 that can be important in viral clearance and other clinical conditions PMID: 29070670
  16. rs368234815 TT/TT genotype associated with severity of fibrosis in nonalcoholic fatty liver disease patients of European ancestry PMID: 28741298
  17. Data show that the genotype distributions of IFNL3 and IFNL4 variants (rs4803217, rs368234815, rs117648444, and rs12979860) were in Hardy-Weinberg equilibrium. PMID: 28394349
  18. Data show that interferon lambda 4 (IFNL4) genotypes determine hepatitis C virus (HCV) viral load through a mechanism dependent on a specific amino acid residue in the HCV NS5A protein. PMID: 28394351
  19. This study provides mechanistic evidence that humans suppress IFNlambda4 expression, suggesting that immune function is dependent on other IFNL family members. PMID: 27799623
  20. Donor IFNL4 TT/TT genotype, a favorable predictor of spontaneous HCV clearance pre-transplant, is associated with increased early post-transplant fibrosis and decreased survival. PMID: 27875564
  21. the association of amino acid substitutions in the HCV core protein and the IFNL3 and IFNL4 polymorphisms with the severity of liver disease, particularly in hepatocellular carcinoma development PMID: 27035616
  22. Population Polymorphism of IFNL3 and IFNL4 Genes of Type 3 Interferon Associated with Spontaneous Clearance of Hepatitis C Virus in Representatives of Caucasian and Mongoloid Races PMID: 27492404
  23. There was no association between IFNL4 polymorphism and HBV susceptibility or natural clearance. PMID: 27236152
  24. this meta-analysis suggests that IFNL4 genetic polymorphism may be a predictor of sustained virological response in chronic hepatitis C patients PMID: 27180197
  25. In this study, there was association of the three isolated polymorphisms (rs8099917, rs12979860 and rs368234815) with both clinical outcome and response to treatment with PEG-IFN and RBV in chronic hepatitis C. PMID: 26973228
  26. There were no statistically significant differences in endogenous interferon-stimulated genes (ISGs) mRNA levels among HIV-1-positive patients bearing different IFNL4 genotypes, suggesting that ISG expression is independent of the IFNL4 genotype in HIV-1 infection. PMID: 27558125
  27. Single-nucleotide polymorphisms (rs12979860) in the intronic region of the interferon-lambda4 (IFNL4) gene modulate liver inflammation and fibrosis, in an etiology independent manner. PMID: 26592354
  28. IFNL4-DeltaG/TT is the primary IFN-lambda region polymorphism for impaired HCV clearance PMID: 26186989
  29. this report shows that NF-kappa B, IRF3, IRF7, and the GC-rich DNA-binding transcription factor, Sp1, have key roles in stimulating transcription from the IFNL4 promoter. PMID: 26684959
  30. Despite differences in protein sequences, functional properties of the recombinant human and nonhuman IFN-l4 proteins are comparable-they are all biologically active for induction of interferon signaling. PMID: 26308395
  31. suggest that IFN-lambda4 protein expression associated with the IL28B-T/T variant preactivates the Janus kinase-Stat signaling PMID: 26896692
  32. HCV infection is proposed to induce a more efficient antiviral response in individuals with the IFNL4 TT/TT genotype that results either in viral clearance or selection for viral adaptations. PMID: 25849245
  33. IFN-l4 may have at least 3 functions in human hepatic cells-activation of interferon signaling, inhibition of cell proliferation, and induction of cell death PMID: 26134097
  34. data on ex vivo derived liver tissue samples argue against an attenuating impact of IFNL3 rs4803217 or IFNL4 rs368234815 minor alleles on hepatic IFNL3 gene expression in vivo. PMID: 26606750
  35. The described is the association with spontaneous hepatitis C viral clearance and genetic differentiation of IL28B/IFNL4 haplotypes in populations from Mexico. PMID: 26741362
  36. The hepatitis C protective allele TT was associated with decreased likelihood of HIV-1 infection in male intravenous drug users [odds ratio (OR): 0.3; P = 0.006], and this association was not modified by the genotype of CCR5. PMID: 26372394
  37. IFNL3 and IFNL4 genotyping could identify those likely to clear naturally and in whom treatment could be delayed, or help prioritize Directly-acting antivirals treatment to those less likely to respond to interferon-containing regimens. PMID: 26150150
  38. IFNL4-DeltaG/TT genotype was not associated with HSV-related outcomes, including episodes of oral or genital herpes PMID: 26431156
  39. Transcriptome analysis reveals a classical interferon signature induced by IFNlambda4 in human primary cells PMID: 26066369
  40. The current study is the first to investigate the effect of IFNL3 and IFNL4 polymorphisms on liver-related mortality. The lower risk of death among African American HIV/HCV-coinfected women is not explained by genetic variation in the IFN-lambda region. PMID: 26115445
  41. Single Nucleotide Polymorphism of Interferon Lambda-4 Gene is not Associated with Treatment Response to Pegylated Interferon in Chronic Hepatitis B. PMID: 26225703
  42. Single-nucleotide polymorphisms (SNPs) in the interferon lambda 4 (IFNL4) gene are predictors for treatment success in patients with hepatitis C virus (HCV) infection PMID: 26406534
  43. Natural selection history of IFNL4-inactivating allele has thus shaped present-day heterogeneity across populations not only in genetic variation, but also in relevant phenotypes and susceptibility to hepatitis C. PMID: 25329461
  44. The IFNL3.rs12979860 and IFNL4.ss469415590 variants have comparable effects on spontaneous resolution of hepatitis C virus infection among Egyptians. PMID: 25788203
  45. Interferon-lambda rs12979860 genotype is a strong aetiology-independent predictor of tissue inflammation and fibrosis in viral and non-viral chronic liver disease. PMID: 25740255
  46. IFNL4 polymorphisms were predictive of treatment outcome only for patients infected with HCV-1. PMID: 25938236
  47. Females with the IFNL4 genotype detected were more likely to have HCV reclearance. PMID: 25883387
  48. We found an independent association of the IFNL4 ss469415590 polymorphism with higher prevalence of AIDS-defining illnesses and lower CD4 T cell numbers. PMID: 25658540
  49. Overexpression of IFNlambda4 suppressed IL28B induction and promoter activation. PMID: 25611696
  50. IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients PMID: 25675103

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted.
Protein Families
Lambda interferon family
Database Links

HGNC: 44480

OMIM: 615090

KEGG: hsa:101180976

UniGene: Hs.745579

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1