Recombinant Human Interleukin-19 (IL19)

In Stock Promotion
Code CSB-EP883391HU
Abbreviation Recombinant Human IL19 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IL-19;Melanoma differentiation-associated protein-like protein;NG.1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-177aa
Target Protein Sequence
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis.
Gene References into Functions
  1. IL-19 was increased in the sera and skin of patients with cutaneous T-cell lymphoma and atopic dermatitis. PMID: 28597022
  2. IL-19 is significantly positive correlated with UAE and Cystatin C. IL-19 may play an important role that contributes to the progression of diabetic nephropathy. PMID: 28201997
  3. The authors identified highly significant associations with better melanoma overall survival for rs6673928, impacting IL19 expression (HR, 0.56; 95% CI, 0.41-0.77; P = 0.0002) and rs6695772, controlling the expression of BATF3 (HR, 1.64; 95% CI, 1.19-2.24; P = 0.0019). PMID: 26733611
  4. a set of IL-17A-regulated genes in keratinocytes, which recapitulate typical psoriasis genes exemplified by DEFB4A, S100A7, IL19 and CSF3, based on the differences in the expression profiles of cells stimulated with six cytokines versus cells stimulated with only five cytokines lacking IL-17A. PMID: 26944069
  5. findings show that the expression of IL19 in biopsies of patients with active ulcerative colitis was increased compared with patients with quiescent ulcerative colitis; microbial-driven expression of IL-19 by intestinal macrophages may contribute to the pathogenesis of inflammatory bowel disease PMID: 28864472
  6. The SNP of IL-19 rs1798 may be associated with susceptibility to hepatitis B in children. PMID: 27974122
  7. The frequency of allele C in rs2243188 was lower in the SLE population. PMID: 27173295
  8. These data are the first to implicate the association between the interleukin-19 and type 2 diabetes mellitus with vascular complications. PMID: 27182008
  9. IL-19 and Ang-2 might be involved in angiogenesis of T2 Diabetes mellitus complications. PMID: 26657726
  10. Data show reduced cytokines IL-10 and IL-19 expression, and enhanced IL-20 and il-1 beta expression in chronic recurrent multifocal osteomyelitis (CRMO) monocytes. PMID: 26404542
  11. The level of IL-19 in the peripheral blood of allergic rhinitis(AR) patients increased and was related with the clinical severity of AR. PMID: 26522365
  12. these findings suggest that molecular features at the IL19 locus may modestly alter the establishment of HIV-1 infection. PMID: 25633979
  13. IL-19 rs2243188 SNP was associated with the susceptibility to lupus nephritis in a Chinese population; but the minor C allele of SNP rs2243188 might be a protective factor for systemic lupus erythematosus PMID: 24819332
  14. These findings indicate that IL-19 production is diminished in SpA. Taken together, impaired IL-19 control of the innate immune system might be involved in the pathogenesis of SpA. PMID: 25639337
  15. Unstimulated and TLR-activated monocytes expressed significantly lower IL-19 mRNA in active CD patients.Exogenous IL-19 had an anti-inflammatory effect on HC but not in CD. PMID: 24718601
  16. IL-19 as a component of the IL-23/IL-17 axis strengthens the IL-17A action and might be a biomarker for the activity of this axis in chronic inflammatory disorders PMID: 25046339
  17. we delineate the detailed molecular pathway for IL-4 up-regulation of IL-19 in keratinocytes, which may play an important role in AD pathogenesis. PMID: 24943510
  18. results suggest that the IL-19 gene might slightly contribute to the genetic risk of schizophrenia. PMID: 24361379
  19. It supresses inflammation and its gene deletion causes inflammatory bowel disease.(review) PMID: 24919552
  20. IL-19 is important for cutaneous wound healing because it upregulates KGF expression. PMID: 23582717
  21. In breast cancer, IL-19 expression is correlated with increased mitotic figures, advanced tumor stage, higher metastasis, and poor survival. (Review) PMID: 23710200
  22. IL-19 does not reduce TNF-alpha-stimulated NF-kappaB activation in Vascular endothelial cells but does decrease serine phosphorylation and cytoplasmic translocation of the mRNA stability factor HuR and significantly reduces stability of ICAM-1 and VCAM-1 mRNA. PMID: 23596173
  23. A significant association was found between the combined genotypes of IL19GC + CC and IL20TG + GG and increased risk of vesicoureteral reflux. PMID: 23000500
  24. subset of fetuses with fetal inflammatory response syndrome had high umbilical cord plasma IL-19 concentrations PMID: 21767236
  25. IL-19 is overexpressed in the epithelium in Chronic rhinosinusitis with nasal polyps and increases epithelial cell proliferation. PMID: 22583192
  26. Methylation in IL-19 is associated with Crohn's disease. PMID: 22021194
  27. IL-19 is pivotal in the pathogenesis of breast cancer. PMID: 22186257
  28. Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1) expression and decreases reactive oxygen species in human vascular smooth muscle cells. PMID: 22158875
  29. protective role of gene polymorphisms in Mexican patients with ulcerative colitis PMID: 21925224
  30. Genetic variation in adaptive immunity genes and particularly in IL19/IL20 genes associates with the development of recurrent wheeze after respiratory syncytial virus lower respiratory tract infection. PMID: 21814157
  31. The minor allele of the IL19 rs2243188 single nucleotide polymorphism was significantly increased in vitiligo patients compared to controls. PMID: 20699607
  32. IL-19 is mitogenic and chemotactic for endothelial cells and can induce their angiogenic potential. PMID: 20966397
  33. Analysis of the IL-19 promoter region shows a fragment of 394 base pairs that supports luciferase activity at a level 7- to 8-fold greater than that of the negative control. PMID: 12370360
  34. an examination of the helical crystal structure of this protein PMID: 12403790
  35. forms stable complex with interleukin-20 receptor PMID: 14580208
  36. IL-19 and IL-20 are synthesized by a distinct population of keratinocytes PMID: 14675174
  37. Elevated IL-19 serum levels in asthmatic patients are positively correlated with levels of IL-4 and IL-13, and suggest that IL-19 may play a role in the pathogenesis of asthma. PMID: 15557163
  38. We identified the sequence TGTGGT (-142 to -138) on PE1 as the binding site for the transcription factor AML1, and crucial for the promoter activity of IL-19 because substituting 1bp in the PE region (-139G-->T) abolished IL-19 promoter activity. PMID: 16631120
  39. Data indicate that adenosine increases the release of IL-19 from bronchial epithelial cells via activation of adenosine A(2B) receptors, and IL-19 in turn activates human monocytes to release TNF-alpha, which upregulates A(2B) receptor expression. PMID: 16778150
  40. study supports the hypothesis that variations of genes of the IL-19 subfamily of cytokines influence susceptibility to palmoplantar pustulosis PMID: 17263806
  41. IL-19 expression in uraemic patients has a role in the Th2 immune responses and may have a role in the cytokine dysregulation in uraemia PMID: 17449492
  42. Review. The role of IL-19 in the pathogenesis of inflammatory diseases is reviewed. PMID: 17465720
  43. data suggest that IL-19 polymorphisms may be associated with age in a Japanese population PMID: 17522354
  44. serum levels of IL-19 were higher in endotoxic shock patients than in healthy volunteers PMID: 18246602
  45. IL-19 expression in vascular smooth muscle cells (VSMCs) may represent a novel, protective, autocrine response of VSMCs to inflammatory stimuli. PMID: 18669613
  46. IL-19 was positively stained in 15 healthy tissue types & 3 major cell types: epithelial cells, endothelial cells & macrophages; several types of tumor cells stained for IL-19, especially squamous cell carcinoma of skin, tongue, esophagus & lung PMID: 18809337
  47. A study of 54 SNPs and haplotypes in the IL10 region indicate that IL10 and IL19/IL20 may be involved in natural clearance of HCV in the African Americans while no significant associations were detected in European Americans. PMID: 15815689
  48. IL-19 upregulates IL-4 expression and the number of IL-4 expressing CD4+ve T-cells PMID: 15120647
  49. IL-19 induces IL-10, which in turn down-regulates IL-19. PMID: 15827959

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-10 family
Database Links

HGNC: 5990

OMIM: 605687

KEGG: hsa:29949

STRING: 9606.ENSP00000343000

UniGene: Hs.661017

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*