Recombinant Human Interferon lambda receptor 1(IFNLR1),partial

Code CSB-EP816871HU1
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. Q8IU57
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
Research Area Immunology
Source E.coli
Gene Names IFNLR1
Protein Names Cytokine receptor class-II member 12Cytokine receptor family 2 member 12
Expression Region 21-228aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info Tag-Free
Mol. Weight 23.6kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Type II cytokine receptor family
Tissue Specificity Widely expressed.
Database Links

HGNC: 18584

OMIM: 607404

KEGG: hsa:163702

STRING: 9606.ENSP00000327824

UniGene: Hs.221375

Pathway Jak-STAT signaling pathway

Related Products

IFNLR1 Antibodies

IFNLR1 Antibodies for Homo sapiens (Human)

IFNLR1 Antibodies for Human

IFNLR1 cDNA

IFNLR1 cDNA for Mus musculus (Mouse)

IFNLR1 cDNA for Homo sapiens (Human)

IFNLR1 ELISA Kit

IFNLR1 ELISA Kit for Homo sapiens (Human)

IFNLR1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.