Recombinant Human Interleukin-6 receptor subunit alpha(IL6R),partial

Code CSB-YP011665HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Uniprot No. P08887
Research Area Immunology
Alternative Names CD 126; CD126; CD126 antigen ; gp80; IL 6R 1; IL 6R alpha; IL 6R; IL-6 receptor alpha chain; IL-6 receptor subunit alpha; IL-6R 1; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL6Q; Il6r; IL6RA; IL6RA_HUMAN; IL6RQ; Interleukin 6 receptor; interleukin 6 receptor; alpha; Interleukin-6 receptor subunit alpha; Membrane glycoprotein 80; MGC30256
Source Yeast
Expression Region 20-365aa
Target Protein Sequence LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 40.5kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.; FUNCTION
Gene References into Functions
  1. The AA genotype for IL6R rs12083537 and CC for rs11265618 polymorphisms for may act as predictors of good response LDA. PMID: 27958380
  2. a significant negative correlation of meprin beta expression and IL-6R levels on human granulocytes, providing evidence for in vivo function of this proteolytic interaction. PMID: 28276471
  3. IL-6/soluble IL-6R differentially regulate RANKL-induced osteoclast differentiation and activity through modulation of NF-kappaB, ERK and JNK signaling pathways. PMID: 28128332
  4. Gene IL6R polymorphic variant rs2228145(C>A) seems to be involved in genetic predisposition of the population of Karelia to nonalcoholic steatohepatitis. PMID: 29797122
  5. IL-6R was shown to be an independent prognostic factor for patients with cervical cancer. PMID: 28741286
  6. Frequency of IL-6R TT (rs4129267) genotype was increased in Ankylosing Spondylitis patients. Interleukin IL-6R (rs4129267) gene polymorphisms could serve as promising biomarkers for diagnosis and prognosis in Ankylosing Spondylitis patients. PMID: 29200018
  7. In a genome-wide meta-analysis of 20,550 patients with Crohn's disease (CD), 17,647 patients with ulcerative colitis (UC), and more than 40,000 individuals without IBD (controls), study found that rs2228145 (scaled to a 2-fold increase in s-IL6R) was associated with reduced risk of CD or UC.[meta-analysis] PMID: 29775600
  8. Analysis of the IL-6 (-572G/C) polymorphism revealed a higher level of the GG genotype in the patients with Celiac Disease compared with the control group. PMID: 28928101
  9. miR-124, IL-6R and STAT3 are involved in the process of sulforaphane-improved CDDP chemotherapy efficacy by targeting cancer stem cell-like properties PMID: 27824145
  10. High IL6-R expression is associated with cisplatin resistance in epithelial ovarian cancer. PMID: 28388577
  11. sIL-6R may be a useful biomarker to assess insulin resistance among morbidly obese subjects PMID: 28346858
  12. Study identified variants associated with the age of onset of Alzheimer's disease in APOE varepsilon4 carriers. Across five datasets, p.D358A had a meta P = 3 x10-4 and an odds ratio = 1.3, 95% confidence interval 1.12 -1.48. Study suggests that a common coding region variant of the IL-6 receptor results in neuroinflammatory changes that may influence the age of onset of Alzheimer's disease in APOE varepsilon4 carriers. PMID: 28106546
  13. IL-6R protein expression on plasma membrane of ovarian cancer cells mediates enhanced cell migration/invasiveness in response to IL6 in ascites. PMID: 27825119
  14. IL6R protein levels were higher in bone than in lymph node and visceral metastases of castration-resistant prostate cancer. PMID: 27344294
  15. IL-6R CC genotype was associated with a three times greater concussion risk and APOE4 with a 40% lower risk in college athletes PMID: 28918391
  16. In the present study, the authors show that deletion of a triple serine (3S) motif (Ser-359 to Ser-361) adjacent to the cleavage site is sufficient to prevent IL-6R cleavage by ADAM17, but not ADAM10. We find that the impaired shedding is caused by the reduced distance between the cleavage site and the plasma membrane. PMID: 27151651
  17. IL6R SNPs are associated with simultaneously high CRP, LDL and ApoB levels. PMID: 28769070
  18. CLL cells with higher CD126 expression are more resistant to treatment. PMID: 26712690
  19. The mRNA expression of IL6R was inversely correlated with miR-449a in osteosarcoma tissues. In addition, JAK1/STAT3 signaling pathway was regulated by circ_0009910/miR-449a/IL6R axis. PMID: 29117539
  20. IL-6 receptor blockade has an effect on high-sensitivity troponin T and NT-proBNP in rheumatoid arthritis PMID: 27744141
  21. Enterovirus 71 antagonizes the antiviral activity of host STAT3 and IL-6R with partial dependence on virus-induced miR-124. PMID: 29120300
  22. we present evidence for the role of M2 phenotype TAM in IL-6 receptor-mediated signals, particularly tyrosine phosphorylation of STAT3, responsible for the prosurvival adaptation of tumor cells to hypoxia. PMID: 26705936
  23. 3 SNPs (rs4329505 and rs4845626 in interleukin 6 receptor [IL6R] and rs1422794 in a disintegrin and metalloproteinase domain 19 [ADAM19]) were associated with a lower risk of suffering the most severe stages of the disease. PMID: 27078193
  24. The expression of STOML2, a gene that plays a key role in mitochondrial function and T-cell activation, is associated with both IL-6 signaling and asthma risk. PMID: 26932604
  25. IL6R is downregulated in the tissues from colonic biopsies taken from Ulcerative Colitis patients.Thus, expression levels of IL6R can be used as markers of disease or disease progression in Ulcerative Colitis patients. PMID: 28774868
  26. expanded CD8(+)IL-6Ralpha(low) EM T cells have roles in coronary artery disease through their pro-inflammatory and highly cytotoxic capacities PMID: 27062409
  27. Both gingival crevicular fluid sIL-6R and calprotectin concentrations are significant biomarkers in the evaluation of periodontal inflammation PMID: 27810997
  28. Our results argued that increased expression of sIL6R from myeloid cells and subsequent c-Maf induction were adverse events for counteracting tumor-specific Th1 generation. Overall, this work provides a mechanistic rationale for sIL6R targeting to improve the efficacy of T-cell-mediated cancer immunotherapy PMID: 28235765
  29. These results demonstrate a novel physiologic role for a disintegrin and metalloprotease 17 in regulating murine IL-6 signals during inflammatory processes. PMID: 26561568
  30. this study show that soluble IL-6R is infiltrating from the circulation in an ADAM17-independent process and is involved in the controlled resolution of an acute inflammatory episode PMID: 27698010
  31. the sIL-6R/p28 fusion protein (FP) upregulated IFN-lambda1 expression by increasing the binding abilities of c-Fos and activating transcription factor 1 to the IFN-lambda1 promoter via the p38 MAPK signaling pathway; results demonstrate the important role of sIL-6R/p28 FP in mediating virus-induced type III IFN production PMID: 27527594
  32. Soluble IL-6R levels appeared to be significantly higher irrespective of disease activity in patients with large-vessel vasculitis. PMID: 28466804
  33. glycosylation is an important regulator for soluble IL-6R generation. PMID: 28060820
  34. IL-6R rs2228145 genotype was associated with decreased risk of gastric cancer for the individuals with negative and positive Helicobacter pylori infection. PMID: 28442395
  35. The here presented data demonstrate that miR-451 may function as a potential suppressor of tumor growth, migration and angiogenesis in osteosarcoma via down-regulating IL 6R. PMID: 27908732
  36. DNA hypomethylation of IL-6 gene measured in blood leukocytes was associated with increased risk of ischemic heart disease. PMID: 26981890
  37. minor allele, with the difference eliminated upon addition of tocilizumab. In conclusion, there is evidence that neutrophils may be an important source of sIL-6R in the lungs, and the Asp358Ala variant may have pro-inflammatory effects in lung cells.d However, we were unable to identify evidence for aisease PMID: 28334838
  38. MiR-451 may function as a potential suppressor of tumor angiogenesis in HCC by targeting IL-6R-STAT3-VEGF signaling, suggesting. PMID: 27461244
  39. high levels of IL-6R expression in spindle-shaped stromal cells, not associated with the vasculature, could be used to identify early breast cancer patients with poor outcomes. PMID: 27460086
  40. No significant association between IL6R rs2228145 and dementia. PMID: 26725994
  41. Rs4845617 of the IL-6R gene is associated with the neurologic status of Korean patients with ischemic stroke. PMID: 26955245
  42. Data suggest domains D1-D3, which contain cytokine binding module, determine which cytokine can activate interleukin-6 or interleukin-11 alpha-receptor subunits; stalk, transmembrane, or intracellular regions do not participate in ligand selectivity. PMID: 26551279
  43. Anti-IL-6R antibody prevented the early loss of intrahepatic islet grafts mediated by HMGB1-induced immune activation after islet transplantation. PMID: 25058889
  44. While prior studies have found an association between PDE4D and IL6R polymorphisms and ischemic stroke, the results of this study suggest that this association may be different in a hypertensive population. PMID: 26782593
  45. Authors identified miR-125a as a direct regulator of IL-6R, and the genotype of rs12976445 might be a novel predictor of the development of DN in DM. PMID: 26563755
  46. results provide evidence that two IL6R gene polymorphisms rs2228145 C and rs12083537 G are associated with poor lung function in patients with asthma. Furthermore, the rs2228145 A-C variant is associated with levels of sIL-6R and IgE. PMID: 26997259
  47. miR-125a-5p directly targets IL-6R and STAT3 expression in HEK-293T cells. PMID: 26424054
  48. High serum IL-6R levels were associated with Chronic Spontaneous Urticaria. PMID: 26699882
  49. findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation PMID: 26329582
  50. Interleukin-6 is strongly affected by factors associated with obesity accounting for its lability and responsiveness to diet, life style and contemporaneous events. PMID: 26086344
  51. The serum levels of VEGF, IL-17, IL-10 and TNF-alpha were lower in the pregnant women with PE when compared with their normotensive peers, while the IL-6 levels were higher PMID: 26205065
  52. Elevated levels of sIL6R were associated with the risk of myocardial infarction and serum levels of sgp130 seemed to modify this association. PMID: 25910182
  53. It was predicted that interleukin-6-receptor (IL6R) was a potential target gene of miR-34a by bioinformatics analysis and identified by luciferase assay. It was further showed that miR-34a inhibited oral cancer progression via IL6R PMID: 25973020
  54. established that endogenous IL-6R of both human and murine origin is shed by ADAM17 in an induced manner, whereas constitutive release of endogenous IL-6R is largely mediated by ADAM10 PMID: 26359498
  55. The aim of this study was to investigate the association of soluble IL-6R levels with myocardial reperfusion after percutaneous coronary intervention (PCI) for acute ST-elevated myocardial infarction. PMID: 25792278
  56. Experimental asthma associated with both high IL-6 and high sIL-6R levels in the airways is attenuated by treatment with IL-6R inhibitors. PMID: 25930193
  57. The rs4845625 of IL6R may be a susceptibility locus for chronic kidney disease in Japanese individuals. PMID: 25524550
  58. IL6R haplotypes regulate the circulating levels of inflammatory biomarkers and lack association with the risk of CHD. PMID: 25781951
  59. All patients presented the putative KS-predisposing G-174C allele of the IL-6 promoter, the wife presenting a homozygosis and the newly affected relatives a heterozygosis, respectively PMID: 24898204
  60. Interleukin 6 receptor is an independent prognostic factor and a potential therapeutic target of ovarian cancer PMID: 25658637
  61. Single nucleotide polymorphisms in IL6R were not associated with increased risk for schizophrenia in a Polish population. PMID: 26198920
  62. Increased expression of the Th17-IL-6R/pSTAT3/BATF/RorgammaT-axis in the tumoural region of adenocarcinoma as compared to squamous cell carcinoma of the lung PMID: 25491772
  63. Data suggest secreted FRP3 (frizzled related protein-3) interacts with ADAM17 (A disintegrin/metalloprotease 17) substrate IL6R (interleukin-6 receptor) release; this interaction is down-regulated in osteoarthritis due to rare double variant in FRP3. PMID: 25846075
  64. Our results suggest that the IL-6R polymorphism may contribute to genetic susceptibility to chronic periodontitis in Northwestern Chinese Han population PMID: 23433353
  65. The goal of our study is to test the association of IL6R rs7529229 polymorphism with coronary heart disease through a case-control study in Han Chinese population and a meta-analysis. PMID: 24971337
  66. no significant effects on group differences or effects of exercise interventions for most of the biological parameters, that is, IL-6, neopterin, 5-HIAA and tryptophan PMID: 24140252
  67. Describe a novel cell-based screening assay for identifying small molecule IL-6R antagonists. PMID: 25345743
  68. In overall analysis, high circulating C-reactive protein (CRP) and interleukin-6 (IL-6) level were significantly associated with shorter OS in NSCLC PMID: 25335739
  69. A variant of the IL6R gene, rs4845625, was found confer risk to atrial fibrillation recurrence after catheter ablation in a Chinese Han population. PMID: 24940886
  70. the presence of the IL-6R 358Ala allele in aortic valve stenosis patients is associated with attenuated systemic inflammatory state and less severe aortic valve stenosis PMID: 24717336
  71. The IL-6R variant interacted with the previously reported COL5A1 and BGN variants to modulate carpal tunnel syndrome risk. PMID: 25813875
  72. In COPD patients there was enhanced airway generation of soluble interleukin-6 receptor. PMID: 25183374
  73. variance of sIL-6R levels can be explained by other variants in the IL6R region, including variants at the 3'-end of IL6R tagged by rs60760897 that are associated with IL6R RNA expression. PMID: 24791950
  74. A close association between an IL-6R polymorphism and cholangiocarcinoma. PMID: 25041016
  75. IL-6 and IL-6R have an additional role in colitis. PMID: 24993179
  76. The present study suggests that IL-6R rs7529229 T/C functional SNP may contribute to the risk of Left main coronary artery disease in a Chinese population. PMID: 24699044
  77. Data show that IL-6 receptor and Stat3 were highly expressed in human cervical squamous cell carcinoma tissues. PMID: 24806843
  78. findings suggest that peripheral sIL-6R level is a potential indicator of affective severity in patients with bipolar disorder. PMID: 24285563
  79. By tag-SNP genotyping based case-control study, we identified a genetic polymorphism in the IL-6R 3'UTR that regulates host resistance to pediatric TB in a Chinese population. PMID: 24772425
  80. miR-451 behaves as a tumor suppressor, probably by targeting the IL6R pathway PMID: 24445140
  81. R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR. PMID: 24802752
  82. identified the region in IL-6R that binds to CANDIS. In contrast to the type I transmembrane proteins, the IL-6R, and IL-1RII, CANDIS does not bind the type II transmembrane protein TNF-alpha, demonstrating differences in the respective shedding by ADAM17 PMID: 24790088
  83. no association between genetic polymorphism and Henoch-Schonlein purpura in Spain PMID: 24498998
  84. The present study supports the view that variants in the rs6684439 SNP of IL-6R is associated with a lower risk of HBV-related HCC, and this could provide valuable clues to understanding the mechanisms underlying susceptibility to this malignant disease. PMID: 24668548
  85. The interleukin-6 receptor Asp358Ala single nucleotide polymorphism rs2228145 confers increased proteolytic conversion rates by ADAM proteases. PMID: 24878322
  86. IL-6R antibody could significantly increase the expression of OPG, but inhibit the expression of RANKL, which might provide a theoretical basis of molecular biology for the prevention and treatment of aseptic loosening of prosthesis. PMID: 24710939
  87. Interleukin-6-receptor polymorphisms rs12083537, rs2228145, and rs4329505 may have a role in response to tocilizumab in rheumatoid arthritis PMID: 24978393
  88. This is the first report demonstrating that heterodimeric combinations of IL-2R and IL-6R subunits are functional for signaling PMID: 23926072
  89. Strong IL-6R expression is associated with poor response to therapy in multiple myeloma patients and may be used as a prognostic marker. PMID: 24118365
  90. Our findings showed a significant statistical association between IL-6 -174 G/C SNP and PCOS risk in South Indian women. T PMID: 24114630
  91. The gene expression of IL-6 and TNF-alpha is increased in active UC. Interleukin 6 is better marker of bowel inflammation because its expression correlates with histological activity PMID: 20423763
  92. rs12083537:A allele significantly increased asthma risk. PMID: 23945879
  93. Asp358Ala (48867A>C) IL6R polymorphism of the A allele is a possible genetic risk factor for MetS; Genotypes AA and AC had a better response to lifestyle modification intervention compared to CC genotype PMID: 23479153
  94. IL-6R/STAT3/miR-34a feedback loop was present in primary colorectal tumors as well as CRC, breast, and prostate cancer cell lines and associated with a mesenchymal phenotype. PMID: 24642471
  95. data suggest that the receptors for IL-6 and TNFalpha, rather than the cytokines themselves, may be better indicators of early vascular changes that are associated with cardiovascular diseases PMID: 24165468
  96. Hepatitis C virus-induced changes in miRNA-449a and miRNA-107 regulate CCL2 expression by activation of the IL-6-mediated signaling cascade by targeting components of the interleukin-6 receptor complex. PMID: 24429361
  97. Anti-IL6 receptor antibody targeting stromal tissue. PMID: 24346288
  98. gene polymorphism (rs2228145) as a predictor of cardiovascular mortality in inflammatory polyarthritis PMID: 24285489
  99. These data suggest that genetic polymorphisms of IL-6RA gene may be associated with disease phenotypes of systemic lupus erythematosus in Korean. PMID: 23594084
  100. study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in women PMID: 23771909

Show More

Hide All

Subcellular Location Isoform 1: Basolateral cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families Type I cytokine receptor family, Type 3 subfamily
Tissue Specificity Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
Database Links

HGNC: 6019

OMIM: 147880

KEGG: hsa:3570

STRING: 9606.ENSP00000357470

UniGene: Hs.135087

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1