Recombinant Human Interleukin-6 receptor subunit alpha(IL6R),partial

Code CSB-YP011665HU
Product Type Recombinant Protein
Size US$191
Uniprot No. P08887
Relevance cytokine receptor activity
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interleukin 6 receptor, isoform CRA_a
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Research Area Immunology
Source Yeast
Protein Names Recommended name: Interleukin-6 receptor subunit alpha Short name= IL-6 receptor subunit alpha Short name= IL-6R subunit alpha Short name= IL-6R-alpha Short name= IL-6RAAlternative name(s): IL-6R 1 Membrane glycopr
Expression Region 20-365aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 40.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.; FUNCTION
Subcellular Location Isoform 1: Basolateral cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families Type I cytokine receptor family, Type 3 subfamily
Tissue Specificity Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
Database Links

HGNC: 6019

OMIM: 147880

KEGG: hsa:3570

STRING: 9606.ENSP00000357470

UniGene: Hs.135087

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Th17 cell differentiation
Inflammatory Pain

Related Products

Antibodies

Antibodies for Homo sapiens (Human)

Proteins

Proteins for Homo sapiens (Human)

ELISA Kit

ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.