Recombinant Human Interleukin-9 receptor (IL9R), partial

Code CSB-YP7225HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP7225HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP7225HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP7225HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Interleukin-9 receptor; IL-9 receptor; IL-9R; CD antigen CD129; IL9R
Species
Homo sapiens (Human)
Expression Region
41-270
Target Protein Sequence
SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for interleukin-9.
Gene References into Functions
  1. Results show that silencing of the IL-9R gene alleviates the drug resistance of diffuse large B-cell lymphoma (DLBCL) cell lines that is induced by IL-9 suggesting that IL-9R is involved in chemotherapy drug resistance of DLBCL. PMID: 27364124
  2. The findings indicated that IL-9R was constitutively expressed and exerted a tumor-promoting effect in hepatocellular carcinoma, whose expression level may be a useful biomarker of tumor invasiveness and patient clinical outcome. PMID: 26082242
  3. Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease. PMID: 25421756
  4. Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis PMID: 24908389
  5. Our findings suggest that overexpression of IL-9R may contribute to the pathogenesis of diffuse large B-cell lymphoma PMID: 23638223
  6. One of the identified peptide sequences corresponded to a fragment of the human interleukin-9 receptor alpha (IL-9Ralpha). PMID: 22638550
  7. There is an association of at least 2 X-chromosomal genes with rheumatoid arthritis: TIMP1 and IL9R. PMID: 19723899
  8. Human bronchial epithelium expresses interleukin-9 receptors. PMID: 11868823
  9. variations in the IL9R gene may influence susceptibility to childhood wheezing and atopy, and data support the notion that different haplotypes may have sex specific influences PMID: 15591265
  10. IL-9R alpha was expressed on human tonsillar B cells, with an ability to transduce signals through activation of signal transducer and activator of transcription 3 and 5. PMID: 17919707
  11. These results reveal a regulatory function for IFN-gamma and IL-10 on modulating the inducible IL-9Ralpha expression levels on peripheral blood neutrophils by T(H)2 cytokines. PMID: 19401191

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted.
Protein Families
Type I cytokine receptor family, Type 4 subfamily
Database Links

HGNC: 6030

OMIM: 300007

KEGG: hsa:3581

STRING: 9606.ENSP00000244174

UniGene: Hs.406228

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1