Recombinant Human Killer cell immunoglobulin-like receptor 2DS1 (KIR2DS1), partial

Code CSB-BP623946HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP623946HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP623946HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
KIR2DS1; CD158HKiller cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member H; MHC class I NK cell receptor Eb6 ActI; CD antigen CD158h
Species
Homo sapiens (Human)
Expression Region
22-245aa
Target Protein Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
Mol. Weight
26.76kD
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.
Gene References into Functions
  1. we demonstrated peptide-dependent binding of the activating NK cell receptor KIR2DS1, providing new insights into the underlying mechanisms involved in KIR2DS1-related disorders. PMID: 28546555
  2. Study findings determined the detrimental impact of KIR2DS1, 2DS5, 3DS1, 2DL5 and CxT4 genotype on genetic predisposition to head and neck squamous cell carcinoma in Iranians. PMID: 29408295
  3. KIR2DS1 expression by decidual natural killer cells increases their ability to control placental HCMV infection PMID: 27956621
  4. A negative association between the KIR2DS1 polymorphism and susceptibility to type 1 diabetes mellitus was found. PMID: 29384924
  5. KIR2DS1 gene polymorphism is associated with HIV-1 infection. PMID: 26888639
  6. The absence of KIR-2DS1 in the mother and the presence of HLA-C2 ligand in the child were negatively associated with type 1 diabetes in the child. Our results indicate that maternal KIR genes and their interaction with foetal HLA-C2 may contribute to the risk of type 1 diabetes among Han Chinese children PMID: 26991115
  7. KIR2DS1-C2C2 is less frequent in type 1 diabetes in Saudi children PMID: 26542066
  8. Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency PMID: 26589762
  9. functional interactions between KIR and HLA modify risks of BCC and SCC and that KIR encoded by the B genes provides selective pressure for altered p53 in BCC tumors. PMID: 26744525
  10. The activating KIR gene KIR2DS1 has an important predictive potential for early onset of type 1 autoimmune hepatitis. PMID: 26744892
  11. Absence of HLA-C2 for donor KIR2DL1 was associated with higher grade II to IV (HR, 1.4; P = .002) and III to IV acute GVHD (HR, 1.5; P = .01) compared with HLA-C2(+) patients. PMID: 25960307
  12. frequency of the maternal KIR2DS1 gene lower in the preeclampsia group than control group PMID: 24911933
  13. Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load. PMID: 25253288
  14. the frequencies of HLA-Cw07 were statistically significantly higher in the patient group than those in the control group (P = 0.009). KIR2DS1(+) HLA(-) Cw(Lys) was more common in subjects with SLE PMID: 25581336
  15. Moreover, the frequency of activating genotypes in the AS patient group was significantly higher than in the healthy control group (P < 0.05). KIR2DS1 and KIR3DS1 PMID: 25491925
  16. Effect of KIR2DS1 was most significant in pregnancies where its ligand, HLA-C2, was paternally but not maternally inherited by a fetus (p = 0.005, odds ratio = 2.65). PMID: 24778445
  17. Different expression levels of KIR2DL1 may contribute to the abnormal function of natural killer (NK) and NKT lymphocytes, which lead to the risk of systemic lupus erythematosus (SLE) susceptibility. PMID: 24839813
  18. A negative association was found between the activating KIR2DS1 gene and multiple sclerosis. PMID: 24529855
  19. Activation of KIR2DS1 positive decidual natural killer cells by HLA-C2 stimulated production of soluble products including GM-CSF. PMID: 24091323
  20. Frequencies of the great majority of KIR genes did not differ between patients and controls, except for KIR2DS1, whose frequency was significantly lower in patients than in controls PMID: 23831511
  21. many NK cells with anti-HLA-C2 reactivity are present in HLA-C1 homozygous and heterozygous donors with KIR2DS1. PMID: 23554313
  22. Activating KIR genes from donors were associated with distinct outcomes of allogeneic HSCT for AML. Donor KIR2DS1 appeared to provide protection against relapse in an HLA-C-dependent manner, and donor KIR3DS1 was associated with reduced mortality. PMID: 22931314
  23. Data found that the frequencies of KIR2DS1, 2DS3 and 3DS1 were significantly higher in pulmonary tuberculosis patients than in the control group. PMID: 22653583
  24. High KIR2DS1 activation is associated with breast cancer. PMID: 21479698
  25. in this cohort, KIR2DS1(+) patients had significantly lower 2-year probabilities of achieving CCyR and OS than KIR2DS1(-) patients. The impact of KIR2DS1 on CCyR was greatest when the ligand for the corresponding inhibitory receptor, KIR2DL1, was absent PMID: 21844874
  26. In this study, KIR2DS1+HLA-C2 and KIR3DL1+HLA-B Bw4 Ile80 combinations were associated with the vulnerability to ankylosing spondylitis. PMID: 21797986
  27. KIR2DS1 expression may also significantly amplify the size of the alloreactive NK cell subset by switching a subset of "not alloreactive" NK cells into potent alloreactive cells. PMID: 21791599
  28. In alloreactive natural killer-cell responses, KIR2DS1 expression represents a remarkable advantage as it allows efficient killing of C2/C2 or C1/C2 myelomonocitic dendritic cells (DCs) and T-cell blasts. PMID: 21355085
  29. This study suggested that the presence of functional compounds of activating KIR receptors together with their HLA ligands, allowing the immunomodulatory function of NK cells, may have a protective role against the disease. PMID: 20826009
  30. Study showed that the activating KIR2DS1 and KIR2DS3 genes associate with fatal outcome in Ebola virus infection. PMID: 20878400
  31. KIR2DS1 has been associated with autoimmunity and hematopoietic stem cell transplantation, these results pave the way to dissect the function of KIR2DS1 in these clinical conditions. PMID: 20093094
  32. KIR3DS1 and KIR2DS1 may be necessary to trigger an effective early immune response against HPV-infected targets to establish resistance to recurrent respiratory papillomatosis PMID: 19861144
  33. individuals carrying three activating KIR genes 3DS1, 2DS1, and 2DS5 are more frequent in patients with Vogt-Koyanagi-Harada disease than in controls PMID: 19897003
  34. KIR2DS1 genes are overrepresented in combination with KIR2DS3, KIR3DS1 and KIR2DS5. PMID: 12559621
  35. The frequencies of KIR2DS1 and KIR2DL5 were significantly increased in psoriasis vulgaris cases compared with controls PMID: 15140215
  36. Results indicate a role of KIR2DS1 on recognition of HLA-Cw6 in susceptibility to psoriasis. PMID: 15310528
  37. An increase in the frequency of the activating KIR2DS1 gene was detected in the psoriatic arthritis (PsA) patients, compared with psoriasis patients negative for PsA and an unaffected American Caucasian control group. PMID: 16112031
  38. The presence of KIR2DS1 in the donor (n = 16/25) was not demonstrated to influence outcome following donor-hematopoietic cell transplantation. PMID: 16504727
  39. Significantly increased KIR2DS1 is associated with systemic lupus erythematosus and scleroderma PMID: 17445179
  40. These results suggest that activating KIR2DS1 gene may not confer susceptibility to PV, and an association of KIR2DS1 gene with the HLA-Cw*0602+ was observed in these patients. PMID: 18643961
  41. KIR2DS1 incompatibilities increased risk of chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation PMID: 19500138
  42. Data show that sHLA-Cw4 or sHLA-Cw3 alleles induced secretion of TGF-beta1 by ligation of stimulatory KIR2DS1 or KIR2DS2 isoforms. PMID: 19830740

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Tissue Specificity
Expressed by NK cells.
Database Links

HGNC: 6333

OMIM: 604952

KEGG: hsa:3806

UniGene: Hs.744319

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1