Recombinant Human Krueppel-like factor 1 (KLF1)

Unavailable
Code CSB-EP619760HUa6
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-362aa
Target Protein Sequence
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 5°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
Gene References into Functions
  1. KLF1 promoted metastasis and invasion via the PI3K/Akt signaling pathway in cervical cancer cells. PMID: 30132534
  2. 3 new mutations were found KLF1*90A (p.Trp30Ter), KLF*911A (p.Thr304Lys), and KLF1*304C,318G (p. Ser102Pro, Tyr106Ter) in 2 unrelated individuals. 2 others had c.954dupG (p.Arg319Glufs*34), that is, KLF1*BGM06. A child with unexplained anemia had c.973G>A (p.Glu325Lys), associated with congenital dyserythropoietic anemia. The common c.304T>C was found in 2 of 7 samples and 60 of 100 blood donors. PMID: 29047116
  3. 4 individuals who were Lua and Lub negative were identified from 5420 unrelated blood donors. KLF1 allele with c.199delA and c.304T>C in Exon 2 was identified in one individual, which caused a frameshift at AA67 and formed a new premature stop codon at nucleotide position 708 p.(Gly68AlafsTer236). One KLF1 allele with c.304T>C and c.604G>A was found in another, which resulted which resulted in p.Ser102Pro and p.Gly202A. PMID: 29193102
  4. AsquareChinesesquarefamilysquarewithsquareKLF1squaremutationsquarecausingsquaremildsquarebeta-squarethalassemia PMID: 29393578
  5. Changes in HbA2 and HbF in alpha thalassemia carriers with KLF1 mutation. PMID: 28342932
  6. Reduction of KLF1 expression in beta(0)-thalassemia/HbE erythroblasts can increase HbF levels. PMID: 29067594
  7. Alterations in high HbF levels may be associated with KLF1 gene mutations. PMID: 28886314
  8. KLF1 enhancer sequence is frequently hypermethylated in juvenile myelomonocytic leukemia. PMID: 28749240
  9. Findings suggest that the induction of an indel mutation in the Kruppel like factor 1 (KLF1) gene leading to a null allele. PMID: 27668420
  10. KLF1 is an important genetic factor associated with increased Hb F and in combination with other modifying factors could explain the phenotypic variation of Hb F expression in this common hemoglobinopathy. PMID: 27282573
  11. Activation of KLF1 at day 10 of the differentiation process when hematopoietic progenitor cells were present, enhanced erythroid commitment and differentiation. PMID: 28026072
  12. Hereditary persistence of fetal hemoglobin in two patients with KLF1 haploinsufficiency due to 19p13.2-p13.12/13 deletion PMID: 27701781
  13. NF-E2, TAL1 and KLF1, all activators play a primary role in HSs formation in the LCR PMID: 27026582
  14. Introduction of the British HPFH mutation into the fetal globin promoter in a human cell model causes elevated fetal globin expression. The British HPFH mutation creates a de novo binding site both in vitro and in vivo for the potent erythroid activator KLF1. PMID: 28659276
  15. A hypothesis on possible liaisons between mutations in the gene encoding EKLF and resistance to pathogens is presented. PMID: 27708211
  16. study reports a novel KLF1 mutation codon 211 A-->G (c.632 A>G) in a family with beta-hemoglobinopathy showing a considerable increase in the HbF level, thus supporting the role of KLF1 in hemoglobin switching PMID: 28369821
  17. seven new alleles in the KLF1 gene, which are presumed to act dominantly to silence LU expression, were identified PMID: 27043150
  18. The prevalence of the In(Lu) phenotype in the Japanese population was 0.02%, and we identified 13 known and 21 novel KLF1 alleles. The KLF1 mutations cause the reduced expression of the P1 antigen. PMID: 28194794
  19. A novel heterozygous mutation was identified in a highly conserved residue in the COOH-terminus of the Kruppel-like factor 1, R360H, that likely altered DNA-binding and impaired transactivation PMID: 27821015
  20. Our study highlighted two novel promoter KLF1 and 3'-region C/EBPalpha motifs in the phenylalanine hydroxylase (PAH) gene which decrease transcription in vitro and, thus, could be considered as PAH expression modifiers. PMID: 27447460
  21. a broad range of hitherto unrelated human red cell disorders are caused by variants in KLF1, a master regulator of erythropoiesis, which were previously considered to be extremely rare causes of human genetic disease [review] PMID: 26903544
  22. results suggest that KLF1 directly regulates the beta-globin gene, but probably has less direct impact on expression of the gamma-globin gene in fetal erythroblasts PMID: 26840243
  23. A KLF1-targeted promoter-reporter assay showed that the two mutations reduce the expression of the HBB, BCL11A, and CD44 genes involved in erythropoiesis. PMID: 25585695
  24. erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage PMID: 26159733
  25. Studies indicate that Kruppel-like factor 1 (KLF1) mutations have been associated with severe hematologic disorders. PMID: 25976964
  26. a successful induction of gamma-globin includes a reduction in BCL11A, KLF1 and TAL1 expression. PMID: 26053062
  27. The study identified the DEK oncoprotein as a critical factor that interacts with an essential upstream enhancer element of the EKLF promoter and exerts a positive effect on EKLF levels. PMID: 26303528
  28. Here we describe a Japanese patient with mild beta-thalassemia with an intact beta-globin gene but a new missense mutation of c.947G > A or p.C316Y in the KLF1 gene which is strongly associated with the expression of the beta-globin gene. PMID: 25690802
  29. The patient with the p.F182L variant (KLF1: c.544T > C) had noticeably high Hb A2 levels (7.6%), consistent with the phenotypic effect of several previously characterized KLF1 mutations in the same exonic region. PMID: 25583416
  30. These results indicate that KLF1 plays a role in facilitating and/or stabilizing GATA-1 and TAL1 occupancy in the erythroid genes, contributing to the generation of active chromatin structure such as histone acetylation and chromatin looping PMID: 25528728
  31. SCF-mediated gamma-globin gene expression in adult human erythroid cells is associated with KLF1, BCL11A and SOX6 down-regulation. PMID: 25457384
  32. KLF1 mutations are associated with increased hemoglobin F and A2 expression. PMID: 25694242
  33. Described is a case of severe neonatal anemia with kernicterus caused by compound heterozygosity for null mutations in KLF1, each inherited from asymptomatic parents. One of the mutations is novel. This is the first described case of a KLF1-null human. PMID: 25724378
  34. Molecular defect in the alpha-globin and beta-globin genes, and in the KLF1 gene were found in the borderline hemoglobin A2 Chinese individuals. PMID: 24857170
  35. expression of erythroid Kruppel-like factor (EKLF) precedes PlGF, and its enforced expression in erythroid progenitor cells induces PlGF mRNA PMID: 24916507
  36. findings suggest that KLF1 mutations occur selectively in the presence of beta-thalassemia to increase the production of HbF, which in turn ameliorates the clinical severity of beta-thalassemia. PMID: 24829204
  37. Select activation-degradation regions like the ones found in EKLF and SREBP1a function in part through their ability to form noncovalent interactions with ubiquitin. PMID: 24139988
  38. The frequency of rare Lu(a-b-) blood group in Shanghai was approximately 0.02%, and all the individuals had an In(Lu) phenotype. The molecular basis of such samples may be related to mutations in the EKLF/KLF1 gene. PMID: 24711040
  39. Mutations in Kruppel-like factor 1 cause transfusion-dependent hemolytic anemia and persistence of embryonic globin gene expression. PMID: 24443441
  40. Data suggest that the Kruppel-like factor 1 (KLF) mutations could be one of the causes of hereditary persistence of fetal hemoglobin (HPFH) in regions where thalassemias are common. PMID: 23806141
  41. KLF1 conscripts the adult-stage beta-globin gene to replace the gamma-globin gene within the active chromatin hub in a stage-specific manner. PMID: 23474875
  42. Regulators, including BCL11A, MYB, and KLF1, hold great promise to develop targeted and more effective approaches for HbF induction PMID: 23209159
  43. Data show that KLF1 haploinsufficiency is responsible for the In(Lu) blood type. PMID: 23125034
  44. Simvastatin and tBHQ suppress KLF1 and BCL11 gene expression and additively increase fetal hemoglobin in primary human erythroid cells. PMID: 23223429
  45. The 1st KLF1 gene promoter mutation (KLF1:g.-148G > A) associated with increased HbF resides in an Sp1 binding site & prevents Sp1 binding. It is involved in human fetal globin gene switching. PMID: 23161389
  46. EKLF mRNA level was significantly decreased in the blood and bone marrow of 5q- syndrome and in all Diamond-Blackfan anemia patients. PMID: 22965552
  47. Mutated KLF1 results in delayed fetal hemoglobin switching in humans, confirming previous in vitro and animal studies and the crucial role of KLF1 in regulating globin gene expression. PMID: 22093801
  48. Studies show that Ppm1b plays a multilayered role in regulating the availability and optimal activity of the EKLF protein in erythroid cells. PMID: 22393050
  49. KLF1 mutations could make a significant contribution to Hb F variance in malarial regions where hemogobinopathies are common. A single altered KLF1 allele is sufficient to increase Hb F levels. PMID: 22102705
  50. Six different KLF1 mutations were identified in 52 of 145 subjects with borderline HBA2 and normal mean corpuscular volume and mean corpuscular hemoglobin. PMID: 21821711

Show More

Hide All

Involvement in disease
Anemia, congenital dyserythropoietic, 4 (CDAN4)
Subcellular Location
Nucleus.
Protein Families
Krueppel C2H2-type zinc-finger protein family
Tissue Specificity
Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.
Database Links

HGNC: 6345

OMIM: 111150

KEGG: hsa:10661

STRING: 9606.ENSP00000264834

UniGene: Hs.37860

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*