Recombinant Human Low molecular weight phosphotyrosine protein phosphatase(ACP1)

Code CSB-EP001176HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P24666
Relevance Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2) Red cell acid phosphatase 1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Research Area Cell Biology
Source E.coli
Gene Names ACP1
Protein Names Recommended name: Low molecular weight phosphotyrosine protein phosphatase Short name= LMW-PTP Short name= LMW-PTPase EC= 3.1.3.48Alternative name(s): Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase
Expression Region 1-158aa
Tag Info N-terminal GST-tagged
Mol. Weight 45.0kDa
Protein Description Full Length of Isoform 1
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.
Subcellular Location Cytoplasm
Protein Families Low molecular weight phosphotyrosine protein phosphatase family
Tissue Specificity T-lymphocytes express only isoform 2.
Database Links

HGNC: 122

OMIM: 171500

KEGG: hsa:52

STRING: 9606.ENSP00000272065

UniGene: Hs.558296

Related Products

ACP1 Antibodies

ACP1 Antibodies for Human

ACP1 Proteins

ACP1 Proteins for Homo sapiens (Human)

ACP1 ELISA Kit

ACP1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.