Recombinant Human Ly6/PLAUR domain-containing protein 6 (LYPD6)

In Stock
Code CSB-EP768237HU
Abbreviation Recombinant Human LYPD6 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
LYPD6
Uniprot No.
Research Area
Neuroscience
Alternative Names
LYPD6; UNQ3023/PRO9821Ly6/PLAUR domain-containing protein 6
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-171aa
Target Protein Sequence
AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Review: Lypd6 reversibly attenuates nAChR-induced membrane responses in CA1 hippocampal interneurons.Whole-cell voltage clamp recordings from a CA1 interneuron showing no effect on induction of inward current by application of Lypd6. (c) An example of whole-cell voltage clamp recordings from a CA1 interneuron showing induction of inward current by application of nicotine (arrow) and attenuation of this current when applied in the presence of Lypd6 (Nic + Lypd6). Nicotine responses were not attenuated with a 3-min interval between applications, indicating that reductions induced in the presence of Lypd6 were not because of cell run down, but were specific to the presence of the protein. (d) An example of whole-cell voltage clamp recordings from a CA1 interneuron, pre-incubated in Lypd6 for 5 min before first application of nicotine, showing that the effect of Lypd6 is lost upon wash-out. The recording examples shown in (c) and (d) are not representing the mean values, but were rather chosen as high- amplitude samples to clearly demonstrate the inhibitory effect of Lypd6.

By Anonymous

Target Background

Function
Acts as a modulator of nicotinic acetylcholine receptors (nAChRs) function in the brain. Inhibits nicotine-induced Ca(2+) influx through nAChRs. Acts as a positive regulator of Wnt/beta-catenin signaling.
Gene References into Functions
  1. the Lynx protein Lypd6 binds to nAChRs in human brain extracts, and that recombinant Lypd6 decreases nicotine-induced ERK phosphorylation PMID: 27344019
  2. Lypd6 appears to control Lrp6 activation specifically in membrane rafts, which is essential for downstream signaling. PMID: 23987510
  3. The cloning and characterization of a novel human LU domain containing gene, LYPD6, isolated from human testis cDNA library, is reported. PMID: 19653121
Subcellular Location
Secreted. Cytoplasm. Cell membrane; Lipid-anchor, GPI-anchor. Cell junction, synapse, synaptosome. Membrane raft.
Tissue Specificity
Ubiquitous. Highly expressed in brain and heart.
Database Links

HGNC: 28751

OMIM: 613359

KEGG: hsa:130574

STRING: 9606.ENSP00000334463

UniGene: Hs.21929

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*