Recombinant Human MAP kinase-activating death domain protein (MADD), partial

In Stock
Code CSB-EP819910HU
Abbreviation Recombinant Human MADD protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
MADD
Uniprot No.
Research Area
Others
Alternative Names
Differentially expressed in normal and neoplastic cells;Insulinoma glucagonoma clone 20;Rab3 GDP/GTP exchange factor;RabGEF;Rab3 GDP/GTP exchange protein;Rab3GEP
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1409-1506aa
Target Protein Sequence
YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Guanyl-nucleotide exchange factor that regulates small GTPases of the Rab family. Converts GDP-bound inactive form of RAB27A and RAB27B to the GTP-bound active forms. Converts GDP-bound inactive form of RAB3A, RAB3C and RAB3D to the GTP-bound active forms, GTPases involved in synaptic vesicle exocytosis and vesicle secretion. Plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. Involved in upregulating a post-docking step of synaptic exocytosis in central synapses. Probably by binding to the motor proteins KIF1B and KIF1A, mediates motor-dependent transport of GTP-RAB3A-positive vesicles to the presynaptic nerve terminals. Plays a role in TNFA-mediated activation of the MAPK pathway, including ERK1/2. May link TNFRSF1A with MAP kinase activation. May be involved in the regulation of TNFA-induced apoptosis.
Gene References into Functions
  1. The risk of coronary disease and ischemic stroke associated with multiple polymorphisms and haplotypes of MADD and FOLH1 in Han Chinese patients are reported in association with alcohol consumption. PMID: 27070640
  2. miR-3151 silencing by DNA methylation protected chronic lymphocytic leukemia cells from apoptosis by over-expression of its direct targets MADD and PIK3R2, constitutive activation of MEK/ERK and PI3K/AKT signaling , and over-expression of MCL1. PMID: 26517243
  3. Taken together, our data reveal that PTEN can convey the death signal by preventing MADD phosphorylation by Akt. PMID: 24038283
  4. These results suggest that MADD may be a potential therapeutic target for lung adenocarcinoma therapy involving the TRAIL-induced apoptosis pathway PMID: 23443411
  5. MADD knockdown resulted in enhanced spontaneous apoptosis in human breast cancer cell lines PMID: 23457619
  6. We analyzed DENN/MADD/IG20 (DMI), the complex of four splice variants in Alzheimer's disease. PMID: 22678883
  7. SNP rs2290149, located in a genetic cluster of MYBPC3 and MADD gene, was found to be associated with diastolic heart failure. PMID: 22529996
  8. Data show that ehe expression of MAPK-activating death domain protein (MADD) increases obviously in lung adenocarcinoma, and MADD can promote survival of lung adenocarcinoma cells by inhibiting apoptosis. PMID: 22482404
  9. The SNP in ADCY5 is implicated in defective proinsulin-to-insulin conversion and previous findings on the role of a genetic variant in MADD on proinsulin-to-insulin conversion, were confirmed. PMID: 21887289
  10. Data show that SNPs from MADD, PROX1, and SLC30A8 were associated with type 2 diabetes. PMID: 21103350
  11. Endogenous MADD is phosphorylated at three highly conserved sites by Akt, and only the phosphorylated MADD can directly interact with the TRAIL receptor DR4 thereby preventing Fas-associated death domain recruitment. PMID: 20484047
  12. Denn is intimately involved in anti-apoptotic and cell survival processes in cancer cells PMID: 12410563
  13. IG20 overexpression enhanced the combined apoptotic effects of TRAIL and gamma-irradiation on HeLa cells. PMID: 14695193
  14. IG20 suppresses tumor cell survival and enhances susceptibility to apoptosis and cancer therapy. PMID: 14716293
  15. DENN has anti-apoptotic and cell survival roles in tumor cells PMID: 14735464
  16. IG20 (MADD splice variant-5) enhances TRAIL-induced apoptosis by increasing recruitment of FADD and caspase-8 to the death-inducing signaling complex. PMID: 15208670
  17. Knockdown of MADD can render cells susceptible to spontaneous apoptosis but had no discernible effect on cell proliferation, colony size or cell cycle progression. MADD alone is sufficient and necessary for cancer cell survival. PMID: 16682944
  18. MADD has a role in the control of cancer cell survival/death as a negative regulator of caspase-8 and confers significant resistance to TRAIL-induced apoptosis PMID: 17314102
  19. data strongly indicate that germline mutations in SPI1 and MADD genes do not confer a high risk of chronic lymphocytic leukaemia and do not make a major contribution to the familial risk of the disease PMID: 17410194
  20. we have identified an essential role for splice variants of the IG20 gene in TRAIL (tumor necrosis factor-related apoptosis-inducing ligand)resistance. PMID: 18223207
  21. Expression of KIAA0358 exerted a potent antiapoptotic effect in both the SK-N-SH and SH-SY5Y neuroblastoma cell lines, whereas expression of IG20-SV4 had proapoptotic effects directly related to the activation of caspase-8 in these cells. PMID: 18794122
  22. KIF1Bbeta- and KIF1A-mediated axonal transport of presynaptic regulator Rab3 occurs in a GTP-dependent manner through MADD. PMID: 18849981
  23. Loss of MADD expression resulted in reduced Grb2 and Sos1/2 recruitment to the TNFR1 complex and decreased Ras and MEKK1/2 activation PMID: 19289468

Show More

Hide All

Subcellular Location
Cell membrane. Cytoplasm. Cell projection, axon.
Protein Families
MADD family
Tissue Specificity
Expressed in testis, ovary, brain and heart. Expressed in spleen, thymus, prostate, testis, ovary, small instestine and colon. Expressed in liver.; [Isoform 1]: Not detected in the brain, breast, kidney, lung, ovary, pancreas, testis, uterus, stomach and
Database Links

HGNC: 6766

OMIM: 603584

KEGG: hsa:8567

STRING: 9606.ENSP00000310933

UniGene: Hs.82548

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*