Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial

In Stock
Code CSB-EP622753HU
Abbreviation Recombinant Human MORC3 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP622753HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MORC3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP622753HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MORC3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
KIAA0136; Microrchidia 3; MORC family CW type zinc finger 3; MORC family CW type zinc finger protein 3; MORC family CW-type zinc finger protein 3; MORC3; MORC3_HUMAN; Nuclear matrix protein 2; Nuclear matrix protein NXP2; NXP2; ZCW5; ZCWCC3; Zinc finger CW type coiled coil domain 3; Zinc finger CW type coiled coil domain protein 3; Zinc finger CW type with coiled coil domain 3; Zinc finger CW-type coiled-coil domain protein 3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-290aa
Target Protein Sequence
MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Human MORC3 protein is expertly crafted to facilitate your research needs. This high-quality, partial protein (1-290aa) is expressed in E. coli and comes with an N-terminal 6xHis-SUMO-tag, ensuring easy purification and detection. With a purity of greater than 90% as confirmed by SDS-PAGE, our MORC3 protein offers reliable and consistent results.

Investigate the complex world of MORC family CW-type zinc finger proteins and their functions with our advanced recombinant protein. Available in both liquid and lyophilized powder forms, our Recombinant Human MORC3 protein is a versatile and valuable addition to your research toolkit.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism. Sumoylated MORC3-NBs can also associate with PML-NBs. Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity. Binds RNA in vitro. May be required for influenza A transcription during viral infection. Histone methylation reader which binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2) and trimethylated (H3K4me3) 'Lys-4' on histone H3. The order of binding preference is H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0.
Gene References into Functions
  1. our studies provide a molecular framework detailing MORC3 functions and suggest that its modulation may contribute to human disease. PMID: 27653685
  2. Dermatomyositis patients with anti-NXP-2 antibodies have a distinct and often severe systemic phenotype that includes myalgia, peripheral edema, and significant dysphagia, despite having milder inflammatory skin disease. PMID: 28129490
  3. MORC3 has antiviral activity during herpes simplex virus 1 and human cytomegalovirus infections. PMID: 27440897
  4. Case Report: manifestations of interstitial lung disease in adult dermatomyositis patient with anti-NPX2 autoantibodies. PMID: 26028648
  5. Downregulation of NXP2/MORC3 by use of two independent short hairpin RNAs reduced virus titers in low-multiplicity infections. Analysis of viral RNA in high-multiplicity infections showed a reduction of viral RNA and mRNA after NXP2/MORC3 downregulation. PMID: 26202233
  6. Case Report: Pemphigus foliaceus associated with anti-NXP2 autoantibody-positive amyopathic dermatomyositis. PMID: 24217940
  7. These studies demonstrate that anti-NXP-2 and anti-TIF-1gamma antibodies are frequent DM specificities (found in 55% of patients) and are present in most patients with cancer-associated dermatomhyositis. PMID: 24037894
  8. An anti-MJ antibody that recognizes NXP-2 was found to be a useful biomarker in dermatomyositis-polymyositis patients. PMID: 22546500
  9. Anti-NXP2 Ab may be associated with adult idiopathic inflammatory myopathies with malignancy. PMID: 22258483
  10. MORC3 colocalizes with PML by a two-step molecular mechanism. PMID: 20501696
  11. determination of nuclear matrix-binding, RNA-binding, and coiled-coil domans PMID: 11927593
  12. When tethered to a promoter by fusion to Gal4, NXP-2 repressed transcription, consistent with a role for NXP-2 in SUMO-mediated repression PMID: 16567619
  13. MORC3 (microrchidia3)-ATPase activated p53 and induced cellular senescence in normal fibroblasts but not p53-/- fibroblasts PMID: 17332504

Show More

Hide All

Subcellular Location
Nucleus, nucleoplasm. Nucleus matrix. Nucleus, PML body.
Tissue Specificity
Expressed in heart, placenta, skeletal muscle, brain, pancreas, lung, liver, but not kidney.
Database Links

HGNC: 23572

OMIM: 610078

KEGG: hsa:23515

STRING: 9606.ENSP00000383333

UniGene: Hs.421150

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*