Recombinant Human Maternal embryonic leucine zipper kinase (MELK), partial

In Stock
Code CSB-EP013692HU1
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
MELK
Uniprot No.
Research Area
Cell Biology
Alternative Names
Maternal embryonic leucine zipper kinase (EC:2.7.11.1);hMELK;Protein kinase Eg3;pEg3 kinase;Protein kinase PK38;hPK38;Tyrosine-protein kinase MELK
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-340aa
Target Protein Sequence
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
44.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Human MELK protein in e.coli cells is a multi-step process, including constructing the expression vector coding for the Human MELK protein (1-340aa), transforming the recombinant vector into e.coli cells, selecting the cells that containing the vector and cultivating them, performing cell lysis, collecting the protein, and characterizing the protein. The resulting recombinant Human MELK protein is purified from the cell lysate through affinity purification, and its purity, determined by SDS-PAGE, is greater than 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
Gene References into Functions
  1. Study demonstrates that the interaction occurring between MELK and EZH2 promotes self-proliferation and stemness. PMID: 28536141
  2. In common culture conditions, the authors found that small molecule inhibition, genetic deletion, or acute depletion of MELK did not significantly affect cellular growth. PMID: 28926338
  3. Synthesis of MCL1, an antiapoptotic protein known to play a role in cancer cell survival during cell division, depends on the function of MELK-elF4B signaling. PMID: 27528663
  4. Inhibition of MELK (genetically and pharmacologically) induces radiation sensitivity. PMID: 27225691
  5. MELK is a host factor required for optimal uncoating of the HIV-1 core to promote viral cDNA synthesis. PMID: 28683086
  6. Here, the authors report that mutagenizing MELK with CRISPR/Cas9 has no effect on the fitness of basal breast cancer cell lines or cell lines from six other cancer types. Cells that harbor null mutations in MELK exhibit wild-type doubling times, cytokinesis, and anchorage-independent growth. PMID: 28337968
  7. MELK-inhibitor has a role in triple-negative breast cancer cells demonstrating context-dependent response with p53 as a key determinant PMID: 28235006
  8. MELK is an oncogenic kinase involved in the pathogenesis and recurrence of hepatocellular carcinoma. PMID: 27693640
  9. Inhibition or depletion of MELK reduced cell proliferation and anchorage-dependent and -independent growth in various ovarian cancer cell lines through a G2/M cell cycle arrest, eventually resulting in apoptosis. PMID: 28214016
  10. Report IL11RA and MELK amplification in gastric cancer cell lines and primary gastric adenocarcinomas. PMID: 27920471
  11. MELK expression in hepatocellular carcinoma is extremely intense compared to its expression reported in other types of cancer and could be a promising effective tumor marker of HCC. PMID: 27798878
  12. targeting MELK by the inhibition of both its catalytic activity and its protein stability might sensitize tumours to DNA-damaging agents or radiation therapy by lowering the DNA-damage threshold PMID: 26431963
  13. Together, these data indicate that MELK is a normally non-essential kinase, but is critical for basal-like breast cancer. PMID: 24844244
  14. EZH2 protects glioma stem cells from radiation-induced cell death in a MELK/FOXM1-dependent manner PMID: 25601206
  15. we report characterization of possible roles of MELK in acute myeloid leukemia PMID: 25365263
  16. insight has been brought by the discovery of a protein complex of FOXM1 with the mitotic kinase MELK in cancer stem cells in brain cancers, as this protein complex appears to be cancer-specific PMID: 25017123
  17. advanced cancers with OTSSP167 started in 2013, as the first-in-class MELK inhibitor. This review summarizes the current molecular understanding of MELK and the recent preclinical studies about MELK as a cancer therapeutic target. PMID: 24795222
  18. MELK promotes cell migration and invasion via the FAK/Paxillin pathway, and plays an important role in the occurrence and development of gastric cancer. PMID: 24885567
  19. our current knowledge of MELK function and recent discoveries in MELK signaling pathway were discussed. PMID: 24185907
  20. The structural and biochemical analyses unravel the molecular mechanisms for the autophosphorylation/activation of MELK and the dependence of its catalytic activity on reducing agents. PMID: 23922895
  21. Report MELK inhibitor that suppresses the growth of a wide range of human tumor cell lines. PMID: 23283305
  22. Data indicate that expression-based risk indices of three genes UBE2C, TPX2, and MELK were more strongly associated with poor 5-year survival in adenocarcinoma patients. PMID: 23357462
  23. MELK is upregulated in high-grade prostate cancer PMID: 22945237
  24. MELK could be associated with increased resistance of colorectal cancer cells against radiation and 5-FU. PMID: 21806965
  25. High MELK is associated with brain tumor. PMID: 21558073
  26. MELK expression is increased in breast cancer tissue and this is associated with poor survival. The most important factors controlling Bcl-G activity are post-translational modification by Fau & MELK. PMID: 19671159
  27. pEg3 is a potential regulator of the G2/M progression and may act antagonistically to the CDC25B phosphatase,pEg3 kinase is able to specifically phosphorylate CDC25B in vitro. One phosphorylation site was identified and corresponded to serine 323 PMID: 12400006
  28. analysis of MELK substrate specificity and activity regulation PMID: 16216881
  29. the kinase activity of MELK is likely to affect mammary carcinogenesis through inhibition of the pro-apoptotic function of Bcl-GL PMID: 17280616
  30. a critical role for MELK in the proliferation of brain tumors, including their stem cells, and suggest that MELK may be a compelling molecular target for treatment of high-grade brain tumors. PMID: 17722061
  31. Maternal embryonic leucine zipper kinase transcript abundance correlates with malignancy grade in astrocytomas PMID: 17960622

Show More

Hide All

Involvement in disease
Defects in MELK are associated with some cancers, such as brain or breast cancers. Expression is dramatically increased in aggressive undifferentiated tumors, correlating with poor patient outcome in breast and brain cancers, suggesting a role in tumor-initiating cells and proliferation via its function in cell proliferation regulation.
Subcellular Location
Cell membrane; Peripheral membrane protein.
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Tissue Specificity
Expressed in placenta, kidney, thymus, testis, ovary and intestine.
Database Links

HGNC: 16870

OMIM: 607025

KEGG: hsa:9833

STRING: 9606.ENSP00000298048

UniGene: Hs.184339

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*