Recombinant Human Matrilysin (MMP7)

In Stock
Code CSB-EP014677HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MMP7
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Matrilysin; Matrin; Matrix Metalloproteinase 7; Matrix metalloproteinase-7; MMP 7; MMP-7; MMP7; MMP7_HUMAN; MPSL1; PUMP 1; Pump 1 protease; Pump-1 protease; PUMP1; Uterine matrilysin; Uterine metalloproteinase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
95-267aa
Target Protein Sequence
YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
46.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The synthesis of the recombinant plasmid containing the gene encoding the Human MMP7 protein (95-267aa) is the first step to produce the recombinant Human MMP7 protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal GST tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Human MMP7 protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Human MMP7 protein, indicating a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
Gene References into Functions
  1. CTHRC1 serves as a pro-metastatic gene that contributes to NSCLC invasion and metastasis, which are mediated by upregulated MMP7 and MMP9 expression. Targeting CTHRC1 may be beneficial for inhibiting NSCLC metastasis. PMID: 29631554
  2. no difference in the expression of MMP-7 and TIMP-1 in the endometrium in relation to hormone levels and menstrual cycle phases were observed PMID: 30187906
  3. MMP-7 A-181G may play an indirect role in determining personal susceptibility to Colorectal Cancer. PMID: 29695403
  4. Results provide evidence that MMP7 expression is regulated by leptin through ERK and JNK pathways to modulate cell invasion of ovarian neoplasm. PMID: 28885729
  5. Absence of MMP-7 Promoter Polymorphisms is associated with Lung Cancer Susceptibility. PMID: 30275186
  6. MMP-7(-181A/G) polymorphisms associate with obesity risk and its severity. PMID: 29317790
  7. Higher serum MMP-7 levels were independently associated with renal fibrosis and poor prognosis in IgA Nephropathy. PMID: 28922659
  8. The results demonstrate that MMP-7 may play an important role in the defensive mechanism against the aggregation of amyloid beta (1-42), which gives rise to the pathology of Alzheimer's disease. PMID: 28871443
  9. among HPV-positive OPSCC patients, high MMP-7 expression is related to worse 5-year DSS and increased rate of distant recurrences PMID: 29721609
  10. MMP7 promoter genotypes only play an indirect role in determining the personal susceptibility to oral cancer in Taiwan. PMID: 29599326
  11. S1P induces advanced tumor phenotypes of hepatocellular carcinoma via establishing an MMP-7/syndecan-1/TGF-beta1 autocrine loop PMID: 27556509
  12. the anti-tumor activity of oleuropein against hepatocellular carcinoma could be attributed to influencing the pro-NGF/NGF balance via affecting MMP-7 activity without affecting the gene expression of NGF PMID: 29476769
  13. These findings suggest the usefulness of combining MMP-7 with CA 125 and HE4 in the diagnosis of epithelial ovarian cancer as a new tumor marker panel. PMID: 28662671
  14. Our findings suggest that the two MMP-7 polymorphisms A-181G and C-153T do not play a major role in determining personal susceptibility to renal cell cancer in Taiwan PMID: 28652430
  15. results suggest that MMP-7 might be involved in the pathogenesis of H. pylori; peptic ulcer was associated with cag pathogenicity island-dependent MMP-7 upregulation PMID: 28699830
  16. Studies have identified an unexpected tumor-suppressive role for host-derived MMP-7 in myeloma bone disease in vivo, and highlight the importance of elucidating the effect of individual MMPs in a disease-specific context. PMID: 28241871
  17. the crosstalk between ARF and MMP7 in nucleus contributes to ECM network in tumor microenvironments in vivo, implicating a novel therapeutic target for advanced PCa treatment. PMID: 27356744
  18. Data suggest that HAI1, a protease on the surface of colon carcinoma cells, is an MMP7 substrate; proteolysis by MMP7 releases extracellular region as soluble HAI1 (sHAI1); sHAI1 induces cancer cell aggregation; cholesterol sulfate is required for MMP-7--catalyzed generation of sHAI1. (HAI1 = hepatocyte growth factor activator inhibitor type 1; MMP7 = matrix metalloproteinase-7) PMID: 29046355
  19. Results indicate that the matrix metallopeptidase 7 (MMP7)A-181G genotype interacts with age and gender and may serve as an early and predictive biomarker for childhood acute lymphoblastic leukemia (ALL). PMID: 29187444
  20. SLC12A5 promoted the migration and invasion of BUC by enhancing MMP-7 expression. PMID: 28333147
  21. Matrix Metalloproteinase-7 Promoter polymorphism is associated with breast Cancer. PMID: 28870920
  22. Data suggest that the cytoplasmic domain of Sdc2 is involved in regulation of expression of MMP7 in colon carcinoma/adenocarcinoma cells; induction of MMP7 involves protein kinase C gamma-mediated FAK/ERK signaling. (Sdc2 = syndecan-2; MMP7 = matrix metalloproteinase-7; FAK = focal adhesion kinase 1) PMID: 28821612
  23. We conclude that in the resected esophageal cancer an increased mRNA expression of MMP-7, MMP-10 and TIMP-1 correlated with clinicopathologic features. We suggest that these genes may play a role during progression of the disease MMP-10, MMP-7, TIMP-1, TIMP-2 were overexpressed in 73%, 85%, 55% and 42% of esophageal cancer samples, respectively. PMID: 28510611
  24. plasma concentrations of MMP-7, MMP-8, -9 and TIMP-1 within 96 h from the onset of acute pancreatitis symptoms are elevated in acute pancreatitis patients compared with healthy controls PMID: 27561093
  25. ZnCo-heterobimetallic analog of cdMMP7 with Co(II) bound in the catalytic site was prepared and characterized. This study describes a well-characterized analog of MMP7 that is available for future inhibitor design efforts. PMID: 27755977
  26. data suggest that syndecan-2 induces extracellular shedding of E-cadherin and supports the acquisition of a fibroblast-like morphology by regulating MMP-7 expression in a colon cancer cell line PMID: 27270030
  27. There were no statistically significant differences in the distribution of MMP7 -181 A/G and MMP12 -82 A/G genotype, allele, or haplotype frequencies between IRSA patients and controls, as well as patients' primary and secondary idiopathic recurrent spontaneous abortion PMID: 27987113
  28. No significant differences were found between MMP-7 A-181G, C-115T, and TIMP-2 G-418C polymorphism and coronary artery disease and myocardial infarction in a Turkish population. PMID: 28137415
  29. MMP-7 is a stable neutral hydrophilic secreted protein, and it may play a vital role in the invasion and metastasis of cancer cells. PMID: 27146730
  30. MMP-7 expression is regulated by SOX18 in prostate cancer. PMID: 27922675
  31. Elevated levels of MMP-7 are Associated with Idiopathic Pulmonary Fibrosis. PMID: 27293304
  32. High MMP2 expression is associated with necrosis in Pancreatic Ductal Adenocarcinoma. PMID: 27429508
  33. Together, these data suggest that IDH2 may be a tumor suppressor in that its loss may promote malignant progression of gastric cancer via NF-kappaB-dependent increases in MMP7 activity. PMID: 26553362
  34. Expression of MMP7 was increased in CRC tissues and cell lines, and inversely correlated with miR-143 expression in CRC tissues. Increased expression of miR-143 repressed MMP7 expression in CRC cells both in mRNA and protein levels. Increased expression of MMP7 reversed the potential influence of miR-143 on CRC cell proliferation and invasion ability. PMID: 27827523
  35. In conclusion, individuals with -181GG genotype and G allele had no impact on susceptibility to the development of HIV-associated neurocognitive disorder and its severity. PMID: 27538541
  36. Together, perlecan fragments in sera and MMP-7 in tissues of Prostate cancer patients are measures of invasive Prostate cancer. PMID: 26862737
  37. The prevalence of matrix metallopeptidase 7 G allele was 40% in studied individuals. PMID: 26950446
  38. Data suggest that, in type 2 diabetes complicated by kidney disease, up-regulation of urinary MMP7 is strongly associated with progression to end-stage renal disease/subsequent mortality; study was conducted in public hospitals in Los Angeles County. PMID: 26412030
  39. Data suggest MMP7 (matrix metalloproteinase 7) in follicular fluid cleaves proNGF (pro-nerve growth factor) in ovarian follicle; both MMP7 and proNGF appear to be products of granulosa cells; processing of proNGF to NGF appears to regulate apoptosis. PMID: 26457789
  40. The multivariate stepwise logistic regression identified the following biomarkers as the best gastric cancer predictors: CEA, CA72-4, pepsinogen I, Helicobacter pylori presence and MMP7 PMID: 27069188
  41. The ELM7 assay was specific towards in vitro MMP-7 degraded elastin. PMID: 26164539
  42. Study shows that MiR-543 inhibits translation of MMP7 through binding to the 3'-UTR of MMP7 mRNA in ovarian cancer. PLGF suppresses miR-543, which activates MMP7-mediated cancer invasion. PMID: 26402225
  43. Protein, mRNA, and serum expression levels of MMP-7 and IL-15 in patients with osteoarthritis were all significantly increased in osteoarthritis patients compared with the control group. PMID: 26464654
  44. Data showed that AEG1 and MMP7 levels were both significantly increased and strongly correlated in non-small cell lung cancer (NSCLC) tissues. AEG-1 promotes NSCLC cell invasiveness through MAPK-p42/p44-dependent activation of MMP7. PMID: 26418251
  45. For the MMP7 -181 A/G polymorphism, a decreased bladder cancer risk was found (G-allele vs. A-allele. PMID: 26301605
  46. In a Chinese population, genetic polymorphisms in MMP7 were associated with risk of coal workers pneumoconiosis. PMID: 26330178
  47. Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway. PMID: 26214021
  48. Urinary MMP7 improves the overall diagnostic performance of urinary CXCL10 for distinguishing normal histology from subclinical and clinical inflammation/injury, but not subclinical inflammation alone. PMID: 26906940
  49. Our data suggested a potential role of Rab11-FIP2 in tumor progression and provided novel insights into the mechanism of how Rab11-FIP2 positively regulated cell migration and invasion in CRC cells. PMID: 26792722
  50. MMP-7 expression is highly specific, though only of moderate sensitivity, for the diagnosis of carcinoma in the differential diagnosis from both benign and malignant mesothelial cells. PMID: 26520416

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Peptidase M10A family
Database Links

HGNC: 7174

OMIM: 178990

KEGG: hsa:4316

STRING: 9606.ENSP00000260227

UniGene: Hs.2256

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*