Name: Recombinant Human Melanoma-associated antigen 10 (MAGEA10)
Brand: CUSABIO
SKU: CSB-EP013324HU

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

MAGEA10

Uniprot No.

P43363

Alternative Names

MAGEA10; MAGE10Melanoma-associated antigen 10; Cancer/testis antigen 1.10; CT1.10; MAGE-10 antigen

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-369aa

Target Protein Sequence

MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

46.3 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The synthesis of the recombinant plasmid containing the gene encoding the Human MAGEA10 protein (1-369aa) is the first step to produce the recombinant Human MAGEA10 protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal 10xHis tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Human MAGEA10 protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Human MAGEA10 protein, indicating a purity level exceeding 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I hope you are well. I have just received an enquiry and I was wondering if you have MAGEA1 and MAGEA10 as purified recombinant proteins in your catalogue? As expression system bacterial, mammalian, yeast or baculovirus are desirable.

Thanks for your inquiry. You haven't specified which species you want. Here we provide the details of human MAGEA1 and MAGEA10 for your reference.
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
CSB-YP013324HU >> Yeast
CSB-EP013324HU >> E.coli
CSB-BP013324HU >> Baculovirus
CSB-MP013324HU >> Mammalian cell
Expression Region: 1-369aa; Full Length
Tag Info: YP: N-terminal 6xHis-tagged; EP: N-terminal 10xHis-tagged; BP, MP: N-terminal 10xHis-tagged together with Myc-tagged
Expression Sequence:

Target Background

Function

Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Gene References into Functions

By using Molecular-Docking, 3 MAGEA10 peptides were found binding to the groove position of HLA-A( *)0210 same as MAGEA4 peptide co-crystallized with HLA-A( *)0210, which indicates they could be promising for HLA-A( *)0201 presentation in immunotherapy. PMID: 26058806
We clearly showed that MAGE-A10 is frequently expressed in the group of triple-negative breast cancer patients PMID: 22116775
High MAGE-A10 is associated with lung, skin and urothelial malignancies. PMID: 21710496
This is the first report of these MAGE-A10 alternative splice sequences, and characterization of MAGE-A expression PMID: 15355897

Subcellular Location

Nucleus.

Tissue Specificity

Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta.

Database Links

HGNC: 6797

OMIM: 300343

KEGG: hsa:4109

STRING: 9606.ENSP00000244096

UniGene: Hs.18048

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address