Recombinant Human Melanoma-associated antigen 10(MAGEA10)

Code CSB-YP013324HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P43363
Relevance Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cancer/testis antigen 1.10
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Research Area Cancer
Source Yeast
Gene Names MAGEA10
Protein Names Recommended name: Melanoma-associated antigen 10 Alternative name(s): Cancer/testis antigen 1.10 Short name= CT1.10 MAGE-10 antigen
Expression Region 1-369aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 42.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Subcellular Location Nucleus
Tissue Specificity Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta.
Database Links

HGNC: 6797

OMIM: 300343

KEGG: hsa:4109

STRING: 9606.ENSP00000244096

UniGene: Hs.18048

Related Products

MAGEA10 Antibodies

MAGEA10 Antibodies for Homo sapiens (Human)

MAGEA10 Antibodies for Human

MAGEA10 Proteins

MAGEA10 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.