Recombinant Human Melanoma-associated antigen 10 (MAGEA10)

In Stock
Code CSB-EP013324HU
Abbreviation Recombinant Human MAGEA10 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
MAGEA10; MAGE10Melanoma-associated antigen 10; Cancer/testis antigen 1.10; CT1.10; MAGE-10 antigen
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-369aa
Target Protein Sequence
MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The synthesis of the recombinant plasmid containing the gene encoding the Human MAGEA10 protein (1-369aa) is the first step to produce the recombinant Human MAGEA10 protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal 10xHis tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Human MAGEA10 protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Human MAGEA10 protein, indicating a purity level exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I hope you are well. I have just received an enquiry and I was wondering if you have MAGEA1 and MAGEA10 as purified recombinant proteins in your catalogue? As expression system bacterial, mammalian, yeast or baculovirus are desirable.

A:
Thanks for your inquiry. You haven't specified which species you want. Here we provide the details of human MAGEA1 and MAGEA10 for your reference.
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
CSB-YP013324HU >> Yeast
CSB-EP013324HU >> E.coli
CSB-BP013324HU >> Baculovirus
CSB-MP013324HU >> Mammalian cell
Expression Region: 1-369aa; Full Length
Tag Info: YP: N-terminal 6xHis-tagged; EP: N-terminal 10xHis-tagged; BP, MP: N-terminal 10xHis-tagged together with Myc-tagged
Expression Sequence:

MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

Target Background

Function
Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Gene References into Functions
  1. By using Molecular-Docking, 3 MAGEA10 peptides were found binding to the groove position of HLA-A( *)0210 same as MAGEA4 peptide co-crystallized with HLA-A( *)0210, which indicates they could be promising for HLA-A( *)0201 presentation in immunotherapy. PMID: 26058806
  2. We clearly showed that MAGE-A10 is frequently expressed in the group of triple-negative breast cancer patients PMID: 22116775
  3. High MAGE-A10 is associated with lung, skin and urothelial malignancies. PMID: 21710496
  4. This is the first report of these MAGE-A10 alternative splice sequences, and characterization of MAGE-A expression PMID: 15355897
Subcellular Location
Nucleus.
Tissue Specificity
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta.
Database Links

HGNC: 6797

OMIM: 300343

KEGG: hsa:4109

STRING: 9606.ENSP00000244096

UniGene: Hs.18048

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*