Code | CSB-EP013324HU |
Abbreviation | Recombinant Human MAGEA10 protein |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The synthesis of the recombinant plasmid containing the gene encoding the Human MAGEA10 protein (1-369aa) is the first step to produce the recombinant Human MAGEA10 protein. After that, the recombinant plasmid is transformed into e.coli cells. e.coli cells capable of enduring a specific antibiotic are selected, demonstrating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions that encourage the expression of the gene of interest. A N-terminal 10xHis tag is linked to the protein. Following expression, affinity purification is employed to isolate and purify the recombinant Human MAGEA10 protein from the cell lysate. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Human MAGEA10 protein, indicating a purity level exceeding 85%.
There are currently no reviews for this product.
I hope you are well. I have just received an enquiry and I was wondering if you have MAGEA1 and MAGEA10 as purified recombinant proteins in your catalogue? As expression system bacterial, mammalian, yeast or baculovirus are desirable.
MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE