Recombinant Human Metallothionein-1G (MT1G), partial

In Stock
Code CSB-EP015113HU1(F2)
Abbreviation Recombinant Human MT1G protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
MT1G
Uniprot No.
Research Area
Cancer
Alternative Names
Metallothionein-1G; Metallothionein-1K; Metallothionein-IG; MT-1G; MT-1K; MT-IG; MT1G; MT1G_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-59aa
Target Protein Sequence
MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.9kDa
Protein Length
Partial?of?Isoform?2
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Gene References into Functions
  1. These findings indicate that MT1 constitute a biomarker adapted for exploring the impact of sorafenib on the redox metabolism of cancer cells. PMID: 27184800
  2. A new tumor-suppressor activity of MT1G in colorectal cancer cells.MT1G role in cell differentiation. PMID: 28393194
  3. PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation PMID: 25072246
  4. MT1G was down-regulated in renal cell carcinogenesis. PMID: 24662736
  5. MT1M and MT1G promoter methylation may be used as serum biomarkers for noninvasive detection of hepatocellular carcinoma. PMID: 24782625
  6. Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy. PMID: 24634414
  7. Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway. PMID: 24098937
  8. GPR56, MT1G, and RASSF1 might be the potential methylation markers associated with acquired multidrug resistance of lung adenocarcinoma. PMID: 23902976
  9. Results describe MT1G promoter hypermethylation in hepatoblastoma and demonstrate that aberrant methylation is a frequent event in this malignancy. PMID: 20032811
  10. Loss of metallothionein 1G function due to hypermethylation of its promoter leads to athogenesis of papillary thyroid carcinoma PMID: 12640681
  11. Induction of the hMT1G promoter by VEGF and heavy metals occurs through the utilization of different transcription factors. PMID: 15735762
  12. Eight MT genes were up-regulated after treatment of T-ALL cells with 0.15 and 1.5 microg/mL of metal ores. Heavy metal binding activity. PMID: 15747776
  13. MT1G is hypermethylated in renal cell carcinoma. PMID: 18639284
  14. Using a panel of four genes (AHRR, p16INK4a, MT1G, and CLDN3) resulted in sensitivity and specificity of 50% and 68%, respectively and may have utility for early detection of esophageal squamous dysplasia and early ESCC. PMID: 19137073
  15. Promoter methylation and differential gene expression of five markers: COL1A2, NPM2, HSPB6, DDIT4L and MT1G were validated by sequencing of bisulfite-modified DNA and real-time reverse transcriptase PCR, respectively. PMID: 19491193
  16. p16INK4A, DAPK1, PTEN and MT1G genes were not frequently methylated in the stage I non-small cell lung cancer in China. PMID: 19506903
  17. MT1G acts as a tumor suppressor gene in hepatocellular carcinoma PMID: 19639168

Show More

Hide All

Protein Families
Metallothionein superfamily, Type 1 family
Database Links

HGNC: 7399

OMIM: 156353

KEGG: hsa:4495

STRING: 9606.ENSP00000391397

UniGene: Hs.433391

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*