Recombinant Human Metallothionein-4(MT4)

In Stock
Code CSB-EP015123HU
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P47944
Lead Time 3-7 business days
Relevance Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Research Area Others
Source E.coli
Gene Names MT4
Protein Names Metallothionein-IV
Expression Region 1-62aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 22.5 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.
Protein Families Metallothionein superfamily, Type 1 family
Database Links

HGNC: 18705

OMIM: 606206

KEGG: hsa:84560

STRING: 9606.ENSP00000219162

UniGene: Hs.567624

Related Products

MT4 Antibodies

MT4 Antibodies for Homo sapiens (Human)

MT4 Proteins

MT4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.