Recombinant Human Methionine synthase reductase (MTRR), partial

Code CSB-YP890659HU?A4)
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP890659HU?A4)
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP890659HU?A4)-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP890659HU?A4)
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP890659HU?A4)
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
MTRR
Uniprot No.
Alternative Names
MTRR; Methionine synthase reductase; MSR; EC 1.16.1.8
Species
Homo sapiens (Human)
Expression Region
533-698
Target Protein Sequence
HASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILTHLKVSFSRDAPVGEEEAPAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQIISKE
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Key enzyme in methionine and folate homeostasis responsible for the reactivation of methionine synthase (MTR/MS) activity by catalyzing the reductive methylation of MTR-bound cob(II)alamin. Cobalamin (vitamin B12) forms a complex with MTR to serve as an intermediary in methyl transfer reactions that cycles between MTR-bound methylcob(III)alamin and MTR bound-cob(I)alamin forms, and occasional oxidative escape of the cob(I)alamin intermediate during the catalytic cycle leads to the inactive cob(II)alamin species (Probable). The processing of cobalamin in the cytosol occurs in a multiprotein complex composed of at least MMACHC, MMADHC, MTRR and MTR which may contribute to shuttle safely and efficiently cobalamin towards MTR in order to produce methionine. Also necessary for the utilization of methyl groups from the folate cycle, thereby affecting transgenerational epigenetic inheritance. Also acts as a molecular chaperone for methionine synthase by stabilizing apoMTR and incorporating methylcob(III)alamin into apoMTR to form the holoenzyme. Also serves as an aquacob(III)alamin reductase by reducing aquacob(III)alamin to cob(II)alamin; this reduction leads to stimulation of the conversion of apoMTR and aquacob(III)alamin to MTR holoenzyme.
Gene References into Functions
  1. 12 articles were included in this study. The pooled results did not reveal a significant association of the MTRR A66G polymorphism (G vs. A: OR = 0.99, 95% CI = 0.82-1.18, p = 0.72) with Nonsyndromic Cleft Lip With or Without Cleft Palate risk PMID: 30004262
  2. The gene polymorphism of MTRR A66G may not be an independent genetic risk factor in deep venous thrombosis in China. PMID: 29927730
  3. The genotypes of three women having spina bifida fetuses from two unrelated Chinese families were screened in candidate alleles. A trinucleotide deletion (c.4_6delAGG) was found in the first exon of MTRR only in the affected women, but not in their siblings with healthy babies or in controls. The Arg2del variant's subcellular localization and catalysis was unchanged, but it failed to efficiently activate MTR. PMID: 28712006
  4. Our results suggest an association between underweight and early childhood caries; in addition it is suggested that MTRR is a common genetic risk factor for early childhood caries and underweight PMID: 28118645
  5. higher frequency of 66GG genotype and 66G allele of MTRR 66A > G polymorphism observed in the women with pre-eclampsia compared to control group PMID: 27806663
  6. An association between the MTRR A66G polymorphism and LC ( p = 0.042) was found. In addition, this allele was observed more frequently in smokers compared to nonsmokers ( p = 0.030). In contrast, the distribution of the MTR 2756A>G and the MTRR 524 C> T allele frequencies were similar in the subject cases and controls. PMID: 28537809
  7. Meta-analysis suggests that MTRR 66A>G polymorphism may be associated with oligoasthenozoospermia risk. PMID: 28436330
  8. Study in Egyptian children showed that MTRR A66G and C524T polymorphisms were associated with a higher congenital heart diseases risk in the homozygote comparison of wild and mutant genotypes and also in heterozygote and mutant comparison. PMID: 28778621
  9. study widens the clinical, molecular, metabolic, and cytological knowledge of deficiency MTRR enzyme. PMID: 25978498
  10. The present study suggests that the G allele of MTR A2756G polymorphism is associated with an increased risk of autism. PMID: 28094822
  11. These findings indicate that the alternatively spliced form of MS expressed in SH-SY5Y human neuronal cells is sensitive to inhibition by thimerosal and neurotoxic metals, and lower GSH levels contribute to their inhibitory action. PMID: 26989453
  12. MTRR genetic polymorphisms are risk factor for predicting cardiovascular manifestations in Marfan syndrome. PMID: 26063524
  13. no association of rs1801394 with non-obstructive azoospermia PMID: 26196053
  14. an association between MTRR 66 and SHMT1 1420 polymorphisms and spaceflight-induced vision changes PMID: 26316272
  15. Results identified an allelic variant in the first intron of MTRR that is associated with increased risk of anencephaly in neural tube defects cases. PMID: 26045171
  16. Findings indicate an association between the single-nucleotide polymorphism A66G in the synthase reductase (MTRR A66G) gene and male infertility, particularly in oligoasthenozoospermia males. PMID: 25966116
  17. The findings of this study provide evidence that multiple sclerosis spinal cord simultaneously lack Cbl, EGF, and PrPCs. PMID: 25888933
  18. Results from the case-control study and meta-analysis suggest that both of the two polymorphisms MTHFR C677T and MTRR A66G Polymorphisms are not associated with being overweight/obesity PMID: 26016497
  19. A decrease of placental expression was noted for MTRR by 50% in pre-eclamptic women as compared to control group. PMID: 25801727
  20. MTRR 66GG genotype showed strong negative association with the risk of childhood brain tumors. PMID: 25809864
  21. More specifically, variants in methionine synthase reductase (MTRR) are not likely associated with capecitabine efficacy. PMID: 25815774
  22. The MTRR polymorphism represents a risk factor for the birth of a child with Down Syndrome among white Caucasian women. [Meta-analysis] PMID: 24965145
  23. MSR 524C/T polymorphism is associated with essential hypertension in ethnic groups in China. PMID: 26252105
  24. Review/Meta-analysis: suggest an association between MTRR A66G polymorphism and colorectal cancer susceptibility among Caucasians. PMID: 26214647
  25. meta analysis demonstrated that MTRR A66G polymorphism is a risk factor for congenital heart defects PMID: 24913415
  26. Heterogeneity across alcohol consumption status of the associations between MTR/MTRR polymorphisms and these cancers indicates potential interactions between alcohol drinking and one-carbon metabolic pathway PMID: 25337902
  27. This meta-analysis suggests that MTRR A66G GG is associated with decreased risk of leukemia in a Caucasian population and in children, especially for ALL. PMID: 24261678
  28. MTRR A66G polymorphisms have not been found to affect the hemostatic system in adolescents with Essential Hypertension. PMID: 25518505
  29. MTRR A66G polymorphism was not associated with breast cancer susceptibility. PMID: 24815481
  30. Reciprocal active site substitutions in CPR (H322A) and MSR (A312H) were created. Interflavin electron transfer was inhibited in CPR H322A and accelerated in MSR A312H. PMID: 24589657
  31. MTRR A66G gene polymorphism is associated with meningioma. PMID: 23959833
  32. Single nucleotide polymorphism in MTRR gene with LINE-1 methylation is associated with breast cancer. PMID: 24130171
  33. The distribution of MTHFR A1298C and MTRR A66G genotypes were not different between the fertile and infertile groups. PMID: 24334125
  34. [meta-analysis] MTRR A66G polymorphisms are not associated with risks for neural tube defects in Caucasian children. PMID: 23425389
  35. The 66GG and AG genotypes were associated with decreased odds ratios for heart defects. This overall association was driven by decreased risk for ventricular septal defect for 66GG and AG and decreased odds ratio for aortic valve stenosis for 66AG. PMID: 22475273
  36. A review of the influences of genetic polymorphisms in methionine synthase reductase on the occurrence of adverse effects from methotrexate therapy. PMID: 23986219
  37. Haplotype analysis suggests an association between MTRR haplotypes and reduced risk of migraine with aura. PMID: 23430981
  38. genetic association studies in population in China: Data suggest that an SNP in MTRR (C524T; S175L; rs1801394) is associated with decreased risk of Down syndrome in this population. PMID: 22925068
  39. maternal MTRR 66A>G polymorphism is associated with an increased risk of having a DS child.[Meta-Analysis] PMID: 23094987
  40. Rs6893114 in MTRR and alcohol consumption are associated with lung cancer risk in current smokers. PMID: 23372658
  41. Results indicate the importance of four gastric cancer susceptibility polymorphisms of IL-10, NOC3L, PSCA and MTRR in the Chinese Han population. PMID: 22796266
  42. The MTRR+66AA genotype may correlate with the severity of HD. PMID: 23039890
  43. studies suggest that SNPs in CBS and MTRR have sex-specific associations with aberrant methylation in the lung epithelium of smokers that could be mediated by the affected one-carbon metabolism and transsulfuration in the cells PMID: 22665368
  44. Known common single-nucleotide polymorphisms in MTRR and BHMT genes may not be significant risk factors for cororonary artery disease. PMID: 22339686
  45. the single-nucleotide polymorphism A66G MTRR is not involved in the development of breast cancer. PMID: 22236648
  46. The variant allele and genotypic frequencies in MTRR A66G gene was significantly higher in patients with UC compared to healthy controls. PMID: 21947961
  47. MTRR A66G polymorphism is a potential biomarker for cancer risk. PMID: 21547363
  48. MTRR A66G and cSHMT C1420T polymorphisms influence CpG island methylator phenotype of BNIP3, thus epigenetically regulating BNIP3 in breast cancer PMID: 21987236
  49. We have demonstrated that the MTRR c.56+781 A>C variant is an important genetic marker for increased congenital heart disease risk because this variant results in functionally reduced MTRR expression at the transcriptional level. PMID: 22179537
  50. MTRR polymorphisms did not appear to be an important genetic factor predisposing to idiopathic infertility in Brazilian men. PMID: 21775772

Show More

Hide All

Involvement in disease
Homocystinuria-megaloblastic anemia, cblE complementation type (HMAE); Neural tube defects, folate-sensitive (NTDFS)
Subcellular Location
[Isoform B]: Cytoplasm.; [Isoform A]: Cytoplasm.
Tissue Specificity
Found in all tissues tested, particularly abundant in skeletal muscle.
Database Links

HGNC: 7473

OMIM: 236270

KEGG: hsa:4552

STRING: 9606.ENSP00000264668

UniGene: Hs.481551

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1