Recombinant Human Myocardin-related transcription factor A (MRTFA), partial

In Stock
Code CSB-EP853375HU1
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
MKL1
Uniprot No.
Research Area
Others
Alternative Names
MKL/myocardin-like protein 1 (Megakaryoblastic leukemia 1 protein) (Megakaryocytic acute leukemia protein)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
400-500aa
Target Protein Sequence
LHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
25.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription coactivator that associates with the serum response factor (SRF) transcription factor to control expression of genes regulating the cytoskeleton during development, morphogenesis and cell migration. The SRF-MRTFA complex activity responds to Rho GTPase-induced changes in cellular globular actin (G-actin) concentration, thereby coupling cytoskeletal gene expression to cytoskeletal dynamics. MRTFA binds G-actin via its RPEL repeats, regulating activity of the MRTFA-SRF complex. Activity is also regulated by filamentous actin (F-actin) in the nucleus.
Gene References into Functions
  1. Depletion of MRTF-A abolished the upregulation of COL1A1 in response to the TGF-beta or Wnt signaling. PMID: 29807221
  2. The data identify the GEF Bcr as a regulator of RhoA/MAL signaling in keratinocytes, which in turn promotes differentiation through the desmosomal cadherin Dsg1. PMID: 23940119
  3. the tumor suppressive role of miR-219a-5p in regulating breast cancer migration by targeting MRTF-A. PMID: 29077787
  4. HDAC4 stimulates MRTF-A expression and drives fibrogenesis in hepatic stellate cells by targeting miR-206 PMID: 28548935
  5. MRTF-A is required for proliferation and formation of mammary acini from luminal epithelial cells. Conversely, elevated MRTF activity results in pre-malignant spheroid formation due to defective proliferation, polarity loss and epithelial-mesenchymal transition. PMID: 28592291
  6. MRTF-A regulated the transcriptional activity of Nrf2 by forming a complex with SRF binding to the CarG box which existed on Nrf2 promoter region, increasing the resistance of tumor cells to doxorubicin. PMID: 28035058
  7. Among a group of tumor cells, there is correlation between activation of the MRTF-dependent transcription and activated FAK-dependent regulation of cell migration. PMID: 27708220
  8. The identification of the miR-206/TWF1/MKL1-SRF/IL11 signaling pathway sheds lights on the understanding of breast cancer initiation and progression, unveils new therapeutic targets, and facilitates innovative drug development to control cancer and block metastasis PMID: 27435395
  9. Herein, we propose a new ILK-MMP9-MRTF axis that appears to be critical for endothelial-mesenchymal transition differentiation of endothelial to cancer-associated fibroblasts -like cells. Thus, it might be an attractive target for cancer treatment PMID: 28893556
  10. CytoD modified MKL1, a coactivator of serum response factor (SRF) regulating CTGF induction, and promoted its nuclear localization. PMID: 27721022
  11. HOTAIR is regulated by the RhoC-MRTF-A-SRF signaling pathway in breast cancer cells. PMID: 28069441
  12. TNF-alpha and LPS promoted the interaction between MKL1 and PCAF. PMID: 28571745
  13. MRTF-A-miR-206-WDR1 form feedback loop to regulate breast cancer cell migration. PMID: 28822708
  14. miR-93-5p regulates myocardin-like 1 and STAT3 to affect epithelial-mesenchymal transition controlling breast cancer cell migration PMID: 28499590
  15. results highlight the critical role of the actin-regulated MRTF transcriptional pathway for bleb-associated invasive motility, such as during entosis. PMID: 28774893
  16. transcriptional co-activator MRTF-A and actin polymerization regulated a subset of miRNAs in vascular smooth muscle. Identification of novel miRNAs regulated by actin/MRTF-A may provide further insight into the mechanisms underlying vascular disease states, such as aortic aneurysm, as well as novel ideas regarding therapeutic strategies PMID: 27939432
  17. Data suggest 2 major isoforms of profilin (Pfn1 and Pfn2) are co-regulated by a common mechanism involving the action of MKL1 [megakaryoblastic leukemia (translocation) 1 protein] that is independent of its SRF- (serum-response factor)-related activity; cellular externalization of Pfn1, rather than transcription, is affected by the perturbations of MKL1; MKL1 can influence cell migration by modulating Pfn1 expression. PMID: 28546428
  18. Study observed a marginally significant association between rs6001946 and the risk of schizophrenia. Results indicated that rs6001946 of the megakaryoblastic leukemia 1 gene is likely a risk factor for schizophrenia. PMID: 27507698
  19. RBM15-MKL1 fusion is associated with acute megakaryoblastic leukemia in non-Down syndrome. PMID: 28063190
  20. The authors show MRTF family proteins bind YAP via a conserved PPXY motif that interacts with the YAP WW domain. This interaction allows MRTF to recruit NcoA3 to the TEAD-YAP transcriptional complex and potentiate its transcriptional activity. PMID: 28028053
  21. The MKL1 promotes ovarian cancer cell migration and invasion by epigenetically activating MMP2 transcription. PMID: 28385531
  22. Data suggest an interplay between megakaryocytic leukemia 1 (MKL1) and ASH2 protein to promote tumor necrosis factor alpha (TNF-alpha) induced proinflammatory transcription in macrophages. PMID: 28218970
  23. The results suggest that integrin-adhesion-induced MRTF-A-SRF activation and ISG15 expression constitute a newly discovered signaling circuit that promotes cell migration and invasion. PMID: 26872785
  24. FLNA functions as a positive cellular transducer linking actin polymerization to MKL1-SRF activity, counteracting the known repressive complex of MKL1 and monomeric G-actin. PMID: 26554816
  25. Redox-sensitive regulation of MRTF-A phosphorylation via palladin in vascular smooth muscle cell differentiation marker gene expression. PMID: 27088725
  26. Identification of SAP-dependent Mkl1 signaling as a previously unrecognized mediator of aggressive progression of mammary tumors locally relapsing after radiotherapy. PMID: 25999144
  27. MRTF-A is a critical for epithelial to mesenchymal transition and can be stereoselectively inhibited by CCG-1423. PMID: 26295164
  28. p300 and MRTF-A synergistically enhance the expression of migration-related genes in breast cancer cells. PMID: 26476216
  29. Myocardin-Related Transcription Factor A and Yes-Associated Protein Exert Dual Control in G protein-coupled receptor- and RhoA-mediated transcriptional regulation and cell proliferation PMID: 26459764
  30. Study found that MRTF-A expression was up-regulated in metastatic anaplastic thyroid cancer tissues and promoted metastasis-relevant traits in vitro. PMID: 25955685
  31. Ddx19 is an RNA export factor required for nuclear import of the SRF coactivator MKL1 PMID: 25585691
  32. AMPK and Akt activation are responsible for the CTRP6-mediated anti-fibrotic effect by targeting RhoA/MRTF-A pathway PMID: 25962701
  33. MKL1 recruited ASH2, a component of the H3K4 methyltransferase complex, to activate MMP9 transcription. PMID: 25746000
  34. MRTF-A and STAT3 synergistically recruited DNMT1 to hypermethylate the promoter of BRMS1 and affect the expression of BRMS1.MRTF-A and STAT3 promote breast cancer cell migration via hypermethylating BRSM1. PMID: 25854163
  35. results revealed that genetic variants in MKL1 might confer risk to schizophrenia. PMID: 25380769
  36. MKL1 deficiency results in actin cytoskeletal disruption in myeloid and lymphoid cell lineages. PMID: 26224645
  37. These data support a central role of the SRF/MRTF pathway in the pathobiology of lung fibrosis. PMID: 25681733
  38. The authors show that Photorhabdus luminescens PTC5 and PTC3 toxins stimulated gene transcription via myocardin-related transcription factor A (also called MAL) and AP1 in HeLa cells. PMID: 25338512
  39. MRTF-A and p300 activated the transcription of VE-cadherin gene by enhancing acetylation of histones. PMID: 25746323
  40. data thus provide important and novel insights into the roles of MRTF-A and STAT3 in regulating MDA-MB-231 cell migration. PMID: 25038455
  41. Data indicate that arginyltransferase 1 (ATE1) function controls Myocardin-related transcription factor A (MRTF-A) activity. PMID: 25381249
  42. Activation of the actin/megakaryoblastic leukemia 1 (MKL1) signaling pathway promotes the hormonal escape of estrogen-sensitive breast cancer cell lines. PMID: 24721635
  43. TGFB1-mediated induction of the short MKL1 isoform initiates progression to later stages of differentiation towards a stationary myofibroblast. PMID: 24424023
  44. We conclude that the -184C>T of MKL1 is an important susceptibility factor for CAD in the Han Chinese in Henan Province PMID: 24615024
  45. This study highlights a crucial role for the transcriptional regulator Mkl1 and its SAP domain during breast cancer progression PMID: 24495796
  46. The actin/MKL1 signalling pathway influences cell growth and gene expression through large-scale chromatin reorganization and histone post-translational modifications. PMID: 24762104
  47. Data suggest that megakaryoblastic leukemia 1 (MKL1) and histone acetyltransferase p300 could augment the expression of catechol-O-methyltransferase (COMT), increase estrogen metabolism, and thus reduce MCF-7 cell proliferation stimulated by estrogen. PMID: 24096006
  48. in both Drosophila and human cellular models that actin is the key target that must be regulated by MAL/SRF for invasive cell migration PMID: 24831700
  49. results provided novel evidence supporting the metastasis-promoting functions of MRTF-A, and implied that MRTF-A might be a switch for the estrogen pathway to change its proliferation-promoting roles into migration-stimulating roles in breast cancer PMID: 24084383
  50. Overexpression of SMYD3 promotes MRTF-A-mediated upregulation of MYL9 and migration of MCF-7 breast cancer cells PMID: 24189459

Show More

Hide All

Involvement in disease
A chromosomal aberration involving MKL1 may be a cause of acute megakaryoblastic leukemia. Translocation t(1;22)(p13;q13) with RBM15. Although both reciprocal fusion transcripts are detected in acute megakaryoblastic leukemia (AMKL, FAB-M7), the RBM15-MKL1 chimeric protein has all the putative functional domains encoded by each gene and is the candidate oncogene.
Subcellular Location
Cytoplasm. Nucleus.
Tissue Specificity
Ubiquitously expressed, has been detected in lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, muscle, heart and brain. Expressed in peripheral blood mononuclear cells (at protein level).
Database Links

HGNC: 14334

OMIM: 606078

KEGG: hsa:57591

STRING: 9606.ENSP00000347847

UniGene: Hs.654688

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*