Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active)

In Stock
Code CSB-EP015307HUc7
Abbreviation Recombinant Human MYL12A protein (Active)
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU),the EC50 is 5.325-6.456 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU). The EC50 is 5.325-6.456 ng/mL.
Target Names
Uniprot No.
Alternative Names
MLCB;MRLC3;RLC
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-171aa
Target Protein Sequence
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Mol. Weight
26.7 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

MYL12A is a non-muscle myosin regulatory light chain that modulates actomyosin contractility, making it a key node in studies of cell migration, cytokinesis, and cancer-associated cytoskeletal remodeling. This full-length recombinant human MYL12A (aa 1–171), expressed in *E. coli* with a C-terminal 6×His tag positioned away from the N-terminal EF-hand domains, preserves the native conformation required for productive protein-protein interactions. Functional ELISA confirms binding activity against an anti-MYL9 recombinant antibody with an EC₅₀ of 5.325–6.456 ng/mL, providing a suitable basis for antibody development, epitope mapping, and use as a positive control in western blot or immunofluorescence workflows. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for structural studies such as crystallography or cryo-EM, as well as cytoskeletal dynamics and polymerization assays investigating actomyosin complex assembly.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
Database Links

HGNC: 16701

OMIM: 609211

KEGG: hsa:10627

STRING: 9606.ENSP00000217652

UniGene: Hs.190086

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*