Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; Kidney derived aspartic protease like protein; NAP1; NAPA; Napsa; NAPSA_HUMAN; Napsin 1; napsin A aspartic peptidase; Napsin A precursor; Napsin-1; Napsin-A; Pronapsin A; SNAPA; TA01/TA02
Species
Homo sapiens (Human)
Expression Region
64-420aa
Target Protein Sequence
KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 64-420 form the expressed segment for recombinant Human NAPSA. This NAPSA protein is expected to have a theoretical molecular weight of 42.5 kDa. This NAPSA recombinant protein is manufactured in e.coli. The NAPSA gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant NAPSA protein during the following stages.
Napsin-A (NAPSA) is a type II aspartic protease enzyme primarily expressed in the human lung, particularly in type II pneumocytes and alveolar macrophages. Functioning as a key marker for lung adenocarcinoma, NAPSA plays a crucial role in the maturation of surfactant protein B within the lungs. Its main function involves the cleavage of proteins during the processing of surfactant precursors, contributing to the maintenance of pulmonary surfactant levels and respiratory function. In research, NAPSA is extensively utilized as a diagnostic tool, aiding in the identification and classification of lung adenocarcinomas, thereby influencing studies related to lung cancer pathology, diagnosis, and potential therapeutic strategies.
