Recombinant Human Napsin-A (NAPSA)

In Stock
Code CSB-EP015452HU
Abbreviation Recombinant Human NAPSA protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP015452HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NAPSA .
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP015452HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NAPSA .
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
NAPSA
Uniprot No.
Research Area
Cell Biology
Alternative Names
Asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; Kidney derived aspartic protease like protein; NAP1; NAPA; Napsa; NAPSA_HUMAN; Napsin 1; napsin A aspartic peptidase; Napsin A precursor; Napsin-1; Napsin-A; Pronapsin A; SNAPA; TA01/TA02
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
64-420aa
Target Protein Sequence
KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of generating recombinant human napsin-A (NAPSA) involves several critical steps, starting with isolating the target gene encoding the human NAPSA
(64-420aa). This gene is co-cloned into an expression vector with an N-terminal 6xHis-tag gene and introduced into E. coli cells via transformation. The positive E. coli cells are selected and induced to express the recombinant NAPSA protein, which is harvested from the cell lysate. Purification of the recombinant NAPSA protein is typically achieved using affinity chromatography. The recombinant NAPSA protein's purity is analyzed by SDS-PAGE, exceeding 90%.

Napsin-A is an aspartic proteinase that plays a crucial role in various physiological processes. It is primarily expressed in the lung and kidney tissues [1][2]. In the lung, napsin-A is detected in normal type II pneumocytes, bronchiolar epithelial cells, and alveolar macrophages [3]. It is involved in the maturation of pro-surfactant protein B in type II pneumocytes and lysosomal protein catabolism in renal cells [4]. Evidence has shown that napsin-A is present in human lung tumors and inflammatory lung lesions, indicating its potential role in lung pathologies [1][2][5]. Furthermore, research has identified napsin-A as an immunohistochemical marker for renal cell carcinoma [6]. Its expression is found in the cytoplasm of pulmonary epithelial cells, renal proximal tubular epithelial cells, and various neoplasms [6].

References:
[1] T. Ueno, S. Linder, & G. Elmberger, Aspartic proteinase napsin is a useful marker for diagnosis of primary lung adenocarcinoma, British Journal of Cancer, vol. 88, no. 8, p. 1229-1233, 2003. https://doi.org/10.1038/sj.bjc.6600879
[2] J. Wu, P. Chu, Z. Jiang, & S. Lau, Napsin a expression in primary mucin-producing adenocarcinomas of the lung, American Journal of Clinical Pathology, vol. 139, no. 2, p. 160-166, 2013. https://doi.org/10.1309/ajcp62wjuamszcom
[3] I. Santos, J. Raiter, E. Lamego, M. Bandinelli, T. Pont, K. Siqueiraet al., Feline pulmonary carcinoma: gross, histological, metastatic, and immunohistochemical aspects, Veterinary Pathology, vol. 60, no. 1, p. 8-20, 2022. https://doi.org/10.1177/03009858221122517
[4] S. Weidemann, J. Böhle, H. Contreras, A. Luebke, M. Kluth, F. Büschecket al., Napsin a expression in human tumors and normal tissues, Pathology & Oncology Research, vol. 27, 2021. https://doi.org/10.3389/pore.2021.613099
[5] F. Berner, D. Bomze, C. Lichtensteiger, V. Walter, R. Niederer, O. Aliet al., Autoreactive napsin a–specific t cells are enriched in lung tumors and inflammatory lung lesions during immune checkpoint blockade, Science Immunology, vol. 7, no. 75, 2022. https://doi.org/10.1126/sciimmunol.abn9644
[6] T. Peat, E. Edmondson, M. Miller, D. DuSold, & J. Ramos‐Vara, Pax8, napsin a, and cd10 as immunohistochemical markers of canine renal cell carcinoma, Veterinary Pathology, vol. 54, no. 4, p. 588-594, 2017. https://doi.org/10.1177/0300985817698211
[9] M. Abdullah, First analysis of expression of napsin-a in ovine pulmonary adenomatosis of sheep and goat at duhok governorate, European Journal of Veterinary Medicine, vol. 3, no. 2, p. 19-23, 2023. https://doi.org/10.24018/ejvetmed.2023.3.2.86

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in processing of pneumocyte surfactant precursors.
Gene References into Functions
  1. These data indicated that napsin A expression may inhibit TGFbetalinduced EMT and was negatively associated with EMTmediated erlotinib resistance, suggesting that napsin A expression may improve the sensitivity of lung cancer cells to EGFRTKI through the inhibition of EMT. PMID: 29845258
  2. Although napsin A is infrequently expressed in endometrial carcinomas, positive results of napsin A immunostaining in endometrial neoplasms might support the diagnosis of clear cell carcinoma when the pathologic differential diagnosis includes other histologic subtypes PMID: 26945446
  3. it may be useful to combine NAPA and TTF-1 for increased sensitivity in lung cancer diagnostics. There is no substantial difference between monoclonal and polyclonal p40 and between different NAPA clones, whereas there is a difference between the TTF-1 clones 8G7G3/1 and SPT24 PMID: 26447895
  4. To the best of our knowledge, expression of monoclonal Napsin A in lymphomas has never been reported. ALK-DLBCL should be considered in the differential diagnosis when evaluating a Napsin A-positive tumor of poorly differentiated morphology and of unknown primary PMID: 26808134
  5. It is important for pathologists to be aware that breast carcinomas with apocrine features can express napsin A. PMID: 26842346
  6. High Napsin A expression is associated with adenocarcinoma in non-small cell lung carcinoma. PMID: 27412420
  7. Napsin-A, and Desmocollin-3 were sensitive and specific markers for the diagnosis of AC and SCC, respectively. Both markers allowed classification of 54/60 cases into either AC or SCC. PMID: 26710975
  8. napsin A is aberrantly expressed in a subset of lymphomas PMID: 26400099
  9. CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed. PMID: 26469326
  10. Combining HNF-1beta and napsin A may distinguish clear cell carcinoma from high-grade serous carcinoma, endometrioid adenocarcinoma and metastatic Krukenberg tumors. PMID: 26339401
  11. napsin A is another sensitive and specific marker for distinguishing ovarian clear cell tumors (especially adenocarcinomas) from other ovarian tumors PMID: 24721826
  12. Napsin A is expressed in a broad spectrum of renal neoplasms. PMID: 25889632
  13. Low expression levels of NAPSA is associated with lung adenocarcinoma. PMID: 25982999
  14. In diagnosis of ovarian clear cell carcinoma, Napsin A is specific but of intermediate sensitivity. PMID: 25551297
  15. Napsin A is frequently expressed in ovarian and endometrial clear cell carcinomas. PMID: 25971546
  16. Data indicate that polyclonal but not monoclonal napsin A antibody has a virtually universal nonspecific labeling in mucinous adenocarcinomas of various sites. PMID: 25521803
  17. These data suggest that napsin A may be a useful marker for identifying metastatic adenocarcinomas of pulmonary origin PMID: 24479710
  18. Our study showed that napsin A is an extremely sensitive (100%) marker of ovarian clear cell carcinomas PMID: 25389337
  19. Napsin A as a marker of clear cell ovarian carcinoma. PMID: 24191930
  20. PAX2 and napsin A have high specificity but low sensitivity and only have limited value in the differential diagnosis of mesotheliomas and renal cell carcinomas PMID: 23503645
  21. TTF-1 is more sensitive than napsin for detection of lung sarcomatoid carcinoma, and no cases were positive for napsin but negative for TTF-1 PMID: 24331839
  22. Napsin A is a sensitive and specific biomarker of the clear cell histotype in endometrial carcinomas and accordingly may have diagnostic utility in their histotyping. PMID: 24145649
  23. 24 cases each of pulmonary and esophageal adenocarcinoma were stained with TTF-1, napsin A, CDX2, 34betaE12, N-cadherin, and IMP3 in an attempt to find an optimal panel for differentiation. IMP3, CDX2, and N-cadherin are superior to either TTF-1 or napsin A. PMID: 23899066
  24. Napsin-A seems to be a useful marker in classifying primary pulmonary neoplasm as adenocarcinomas. PMID: 22914608
  25. A minority of anaplastic and poorly differentiated micropapillary pattern thyroid carcinomas are napsin A positive. PMID: 23681073
  26. Napsin B was duplicated from napsin A during the early stages of primate evolution, and the subsequent loss of napsin B function during primate evolution reflected ongoing human-specific napsin B pseudogenization PMID: 23333608
  27. Mucin-producing neoplasms of the lung infrequently express napsin A, suggesting that immunohistochemical assessment of napsin A may have limited diagnostic usefulness for distinguishing primary and metastatic mucinous adenocarcinomas involving the lung. PMID: 23355200
  28. investigation of expression of NAPSA (a potential diagnostic marker) in lungs/respiratory mucosa of subjects with pulmonary sclerosing hemangioma PMID: 23194051
  29. a useful immunohistochemical marker for differentiation of lung squamous cell carcinoma and adenocarcinoma from other subtypes PMID: 22495379
  30. absence of napsin A was an independent prognostic factor for reduced survival time in lung adenocarcinoma PMID: 22418245
  31. Nap-A was more specific than thyroid transcription factor 1 for primary lung adenocarcinoma versus all tumors, excluding kidney, independent of tumor type PMID: 22288963
  32. None of the 90 squamous cell carcinomas of the lung exhibited napsin A positivity in the neoplastic cells; however, strong napsin A reactivity was observed in hyperplastic type II pneumocytes and in intra-alveolar macrophages entrapped within the tumor. PMID: 22198009
  33. napsin A is a useful marker that can assist in the diagnosis of both lung adenocarcinomas and renal cell carcinomas[review] PMID: 22156835
  34. in combination with thyroid transcription factor-1-positive immunostaining helps in differentiating primary lung adenocarcinoma from metastatic carcinoma in the lung PMID: 21464700
  35. Although TTF-1 had a higher sensitivity, napsin-A was useful as a surrogate marker when encountering a poorly differentiated lung adenocarcinoma. PMID: 20830690
  36. Pronapsin A gene expression in normal and malignant human lung and mononuclear blood cells PMID: 12151090
  37. Napsin is a promising marker for the diagnosis of primary lung adenocarcinoma. PMID: 12698189
  38. role in the N- and C-terminal processing of pro-surfactant protein-B in type-II pneumocytes PMID: 13129928
  39. NAPSA suppresses tumor growth independent of its catalytic activity. PMID: 18195689
  40. A general defect in napsin A or cathepsin H expression or activity was not the specific cause for abnormal surfactant accumulation in juvenile pulmonary alveolar proteinosis PMID: 18216060
  41. The combined use of napsin A and thyroid transcription factor-1 results in improved sensitivity and specificity for identifying pulmonary adenocarcinoma in primary lung tumors and in a metastatic setting. PMID: 19740516

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase A1 family
Tissue Specificity
Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
Database Links

HGNC: 13395

OMIM: 605631

KEGG: hsa:9476

STRING: 9606.ENSP00000253719

UniGene: Hs.512843

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*