Recombinant Human Natural killer cell receptor 2B4(CD244),partial

Code CSB-EP861192HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names CD244
Uniprot No. Q9BZW8
Research Area Immunology
Alternative Names 2B4; C9.1; CD244; CD244 antigen; CD244 molecule; CD244 molecule natural killer cell receptor 2B4 ; CD244 natural killer cell receptor 2B4; CD244_HUMAN; F730046O15Rik; h2B4; Ly90; NAIL; Natural killer cell activation-inducing ligand; Natural killer cell receptor 2B4; NK cell activation inducing ligand; NK cell activation inducing ligand NAIL ; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NKR2B4; Nmrk; Non-MHC restricted killing associated; OTTHUMP00000027884 ; p38; signaling lymphocytic activation molecule 4; SLAM family, member 4; SLAMF4
Species Homo sapiens (Human)
Source E.coli
Expression Region 21-215aa
Target Protein Sequence GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 48.5 kDa
Protein Length Partial
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Heterophilic receptor of the signaling lymphocytic activation molecule (SLAM) family; its ligand is CD48. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Acts as activating natural killer (NK) cell receptor
Gene References into Functions
  1. Sole engagement of NKG2D, 2B4 or DNAM-1 is insufficient for NF-kappaB activation. PMID: 27221592
  2. We determined a significantly lower expression of CD244 on monocytes in systemic lupus erythematosus patients compared to healthy controls. Furthermore, monocyte CD244 expression was negatively associated with several serum autoantibody titres. PMID: 28593610
  3. SLAMF4 is a marker of intestinal immune cells which contributes to the protection against enteric pathogens and whose expression is dependent on the presence of the gut microbiota PMID: 28341747
  4. The present study provides further insights into the role of the 2B4-CD48 interaction in the fine regulation of CD8(+) T-cell effector function upon antigenic stimulation. PMID: 26860368
  5. Data show that 2B4 not only can bind to CD48 in trans but also interacts with CD48 in cis by using the same binding interface. Also, the results demonstrated that constitutive phosphorylation of 2B4 occurs only in the presence of CD48, and that cis binding is sufficient to induce substantial levels of baseline phosphorylation. PMID: 27249817
  6. 2B4 expression is increased on CD4+ T cells in septic patients PMID: 28768726
  7. Self-iNKR(-) NK cells in X-linked lymphoproliferative disease 1 patients are functional even in resting conditions, suggesting a role of the inhibitory 2B4/CD48 pathway in the education process during NK-cell maturation. PMID: 28386908
  8. our results provide strong evidence that CD244 co-operates with c-Kit to regulate leukemogenesis through SHP-2/p27 signaling. PMID: 28126968
  9. SLAMF4 gene and surface protein expression was down-regulated in CD8+ T cells from SLE patients compared with that in cells obtained from healthy donors. SLAMF4+ effector memory cells produced more granzyme B and perforin than SLAMF4- cells. PMID: 26314831
  10. GSK-3 undergoes inhibitory phosphorylation at regulatory serine residues by the engagement of NKG2D and 2B4, either individually or in combination. PMID: 26022178
  11. Cytomegalovirus-Induced Expression of CD244 after Liver Transplantation Is Associated with CD8+ T Cell Hyporesponsiveness to Alloantigen PMID: 26170387
  12. CD8(+) T cells require 2B4 for Epstein-Barr virus-specific immune control, because 2B4 blockade after CD8(+) T-cell depletion did not further aggravate symptoms of the infection. PMID: 25722295
  13. CD244 expression/signaling in tuberculosis correlates with high levels of a long noncoding RNA (lncRNA)-BC050410 [named as lncRNA-AS-GSTT1(1-72) or lncRNA-CD244] in the CD244(+)CD8(+) T-cell subpopulation. PMID: 26150504
  14. show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4 PMID: 25824372
  15. this study investigates the structural requirements for the recruitment of the human-activating NK-cell receptors NKG2D and 2B4 to detergent-resistant membrane fractions in the murine BA/F3 cell line and in the human NK-cell line NKL. PMID: 25545687
  16. Study of SAP expression is specific but may have insufficient sensitivity for screening XLP1 as a single tool; however, combination with 2B4 functional assay allows identification of all cases PMID: 24985396
  17. Blockade of 2B4/CD48 interaction resulted in improvement in function via perforin expression and degranulation as measured by CD107a surface mobilization on HTLV-1 specific CD8+ T cells. PMID: 24505299
  18. In patients suffering from X-linked lymphoproliferative disease (XLP1), SAP is nonfunctional, not only abolishing the activating function of 2B4, but rendering this receptor inhibitory. PMID: 24659462
  19. XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells. PMID: 24496997
  20. Our results indicate that rapid CD244 internalization is induced by a two-signal mechanism and plays a role in modulation of antiviral CD8 T cell responses PMID: 23913963
  21. data describe immune escape mechanism of monoclonal gammopathy/multiple myeloma occuring via downregulation of 3 major activating NK receptors (NCR3/NKp30, NKG2D and CD244/2B4/p38) in bone marrow, that was undetectable in peripheral blood. PMID: 23360454
  22. Monocyte-induced natural killer cell dysfunction was markedly attenuated by blocking CD48 receptor 2B4 on NK cells, but not by blockade of NKG2D and NKp30. PMID: 23225218
  23. TGF-beta1 may reduce the expression of NKG2D/DAP10 and 2B4/SAPin patients with hepatitis B. PMID: 22438812
  24. These results identify a novel role for 2B4 molecules in eosinophil functional migratory response and may point to a novel tyrosine kinase-mediated ligation between CCR3 receptor and 2B4 co-receptor in eosinophil chemotaxis. PMID: 22230401
  25. 2B4 is an important molecule within the network of costimulatory/inhibitory receptors regulating CD8+ T cell function in acute and chronic hepatitis C and 2B4 expression levels could also be a marker of CD8+ T cell dysfunction. PMID: 21625589
  26. The results obtained through a cohort of European Caucasian Systemic sclerosis patients do not support the implication of CD244 gene in the pathogenesis of SSc but the gene were identified as Rheumatoid arthritis susceptibility gene. PMID: 21586211
  27. glycosylation has an important impact on 2B4-mediated NK cell function and suggest that regulated changes in glycosylation during NK cell development and activation PMID: 21606496
  28. These results suggest a potential physical association between 2B4 and the ITAM receptor complexes that is required for 2B4-initiated signaling and cell-mediated killing. PMID: 21439641
  29. Data show that an increase in 2B4-expressing NK cells and a decrease in NKp46(+) NK cells occurred following intramuscular influenza vaccination. PMID: 21214542
  30. Engagement of the activating natural killer (NK) cell receptor 2B4 rapidly mediates an increase in the force necessary to separate NK cells from tumor cells. PMID: 21270395
  31. analysis of the importance of homotypic NK-to-NK cell cross-talk through 2B4/CD48 and CD2/CD58 pairs and further present their differential and overlapping roles in human NK cells PMID: 20813844
  32. Single nucleotide polymorphisms of CD244 gene predispose to renal and neuro-psychiatric manifestations with systemic lupus erythematosus. PMID: 20437071
  33. CD244 and PD-1 are highly coexpressed on virus-specific CD8+ T-cells in chronic HBV infection and blocking CD244 or its ligand CD48 may restore T-cell function independent of the PD-1 pathway. PMID: 21064032
  34. Single nucleotide polymorphism in CD244 gene is associated with rheumatoid arthritis. PMID: 18794858
  35. altered expression of splice variants of CS1 and 2B4 that mediate differential signalling in PBMC from patients with SLE. PMID: 20345977
  36. Major histocompatibility class (MHC) I proteins expressed on natural killer (NK) cells inhibit NKR2B4 receptor self-killing not only by serving as an inhibitory ligand for inhibitory NK receptors but also through the association with 2B4. PMID: 20164429
  37. Data show that pair-wise ligations of 2B4 with DNAM-1 and/or NKG2D lead to increased effector functions of primary CD4(+)CD28(-) T cells to suboptimal levels of anti-CD3 stimulation. PMID: 19904767
  38. Up-regulation of the activatory receptor 2B4 by CD8+ alpha beta T cells in vivo correlates with the acquisition of effector cell properties such as granzyme B and perforin expression, IFN-gamma production, and down-regulation of chemokine receptor CCR7. PMID: 11714776
  39. 2B4-mediated activation of natural killer cells involves the complex interactions of LAT, Ras, Raf, ERK and p38 kinase in the regulation of lytic function and cytokine production. PMID: 11714782
  40. X-linked lymphoproliferative disease causes impaired 2b4 function in NK cells. PMID: 11774610
  41. expressed on CD3+/CD56+ large granular lymphocytes proliferating in response to a tumor-expressed activating ligand (CD48) and killing autologous leukemia cells by a novel mechanism in a patient with acute myeloid leukemia. PMID: 11986947
  42. Natural killer cell inhibitory receptors block actin cytoskeleton-dependent recruitment of 2B4 (CD244) to lipid rafts. PMID: 12515815
  43. engagement of 2B4 on NK cells triggered a tyrosine phosphorylation signal PMID: 15169881
  44. expression significantly up-regulated on CD4 and CD8 T cells during infectious mononucleosis, and significantly more lymphocytes expressing CD8 and CD244/CD8 in patients with severe sore throat. PMID: 15195244
  45. The function of 2B4 as an adhesion molecule is underscored and a relevant role is suggested in the initial binding, scanning of target cells, and formation of cytotoxic natural killer cell immune synapse. PMID: 15356108
  46. the SAP/2B4 pathway plays a key role in CTL lytic activity against EBV-positive targets by promoting the polarization of the lytic machinery PMID: 15677558
  47. analysis of the molecular basis for the different signals generated by 2B4 PMID: 15713798
  48. Functional analysis indicates that Lys-68 and Glu-70 in the extracellular domain of human 2B4 play a key role in the activation of human natural killer (NK) cells through 2B4/CD48 interaction. PMID: 16002700
  49. Review of recent studies suggests an important role for interactions between 2B4 and CD48 in the course of T cell activation and proliferation PMID: 16081768
  50. CD244-3BP2 association regulates cytolytic function but not IFN-gamma release PMID: 16177062
  51. blocking the engagement of 2B4, NTB-A and CRACC has no effect on the proliferation or development of the cytotoxic potential of NK cells but triggering by their physiological ligands on MHC class I-negative target cells induces potent NK cell cytotoxicity PMID: 16410313
  52. 2B4 (CD244) can stimulate NK cell cytotoxicity and cytokine production by interacting with NK cell expressed CD48 and adds CD48 to the growing number of activating NK cell receptors PMID: 16585556
  53. REVIEW: different functions of the murine and human 2B4 (CD244) receptor on NK cells PMID: 16621032
  54. CD48 is a CD2 and CD244 (2B4)-binding protein PMID: 16803907
  55. The lower surface expression of 2B4 after ligand-induced down-modulation results in reduced 2B4-mediated NK cell activation and cytotoxicity. PMID: 17111350
  56. The triggering of 2B4 (CD244) alone is sufficient to induce natural killer (NK) cell cytotoxicity in IL-2-activated NK cells with high SLAM-associated protein expression. PMID: 17171759
  57. stimulation of natural killer cells through surface 2B4 (CD244) down-regulates its own expression due to a reduction in the promoter activity at the Ets element PMID: 17300754
  58. the mechanism of signal transduction by CD244 is to regulate FYN kinase recruitment and/or activity and the outcome of CD48/CD244 interactions is determined by which other receptors are engaged. PMID: 17599905
  59. HTLV-1-infected CD4+ T cells did not express ligands for NK cell activating receptors, NCR and NKG2D, although they did express ligands for NK cell coactivating receptors, NTB-A and 2B4. PMID: 17609265
  60. 2B4, NTB-A and CRACC have roles in the regulation of Natural Killer cell function [review] PMID: 17981603
  61. 3BP2 acts downstream of SAP, increases CD244 phosphorylation and links the receptor with PI3K, Vav, PLC gamma, and PKC downstream events in order to achieve maximum natural killer cell killing function. PMID: 18479751
  62. Studies under identical and controlled conditions reveal that both human and mouse 2B4 can activate or inhibit natural killer (NK) cells. PMID: 18523281
  63. Down-regulation of 2B4 isoforms may be an important factor in controlling NK cell activation during immune responses. PMID: 19499526
  64. CD244 inhibition and activation depends on CD2 and phospholipase C-gamma1 PMID: 19586919
  65. the 2B4 receptor has a potent costimulatory effect in NK cells PMID: 19638467
  66. CD244 is not associated with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in a Korean population. PMID: 19790054

Show More

Hide All

Subcellular Location Membrane, Single-pass type I membrane protein, Cell membrane
Tissue Specificity Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed in all natural killer (NK) cells, monocytes and basophils, TCR-gamma/delta+ T-cells, monocytes, basophils, and on a subset of CD8(+) T-cells.
Database Links

HGNC: 18171

OMIM: 605554

KEGG: hsa:51744

STRING: 9606.ENSP00000357012

UniGene: Hs.157872

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1