Name: Recombinant Human Neuroglobin (NGB)
Brand: CUSABIO
SKU: CSB-EP015776HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NGB

Uniprot No.

Q9NPG2

Research Area

Transport

Alternative Names

Neuroglobin; NGB; NGB_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-151aa

Target Protein Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.9kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I would like to ask about Recombinant Human Neuroglobin (NGB) CSB-EP015776HU. Is it possible to prepare the sample in liquid form with approximately 10% of glycerol content?

We could offer this protein in liquid format with approximately 10% of glycerol content. We could offer this protein in different buffer according to your experiment requests.

I have a question what formulation is the CSB-EP015776HU protein stock in? We need it without the addition of trehalose and sacrosyl.

Please kindly know that CSB-EP015776HU currently has lyophilized powder in stock, (Lyophilized from 20 mM Tris HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.) As you request no trehalose, we can arrange dialysis of the stock protein or prepare a new batch of liquid protein.

Target Background

Function

Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis.

Gene References into Functions

Neuroglobin functions as an important modulator of the Wnt/beta-Catenin and NFkappaB signaling pathway through direct interaction with Dishevelled-1. PMID: 30041403
This study demonstrated that serum NGB levels were significantly associated with 6-month unfavorable outcomes, indicating that Ngb can play a role in predicting 6-month unfavorable outcomes. PMID: 29738858
Results show that the expression of NGB in glioma is grade related and is negatively regulated at the transcriptional level by PPARgamma suggesting an important role of NGB in glioma progression. PMID: 28410531
The authors demonstrate that Glu53, Glu60, and Glu118 of human Ngb are crucial for both the neuroprotective activity and interaction with Gi. Moreover, they show that Lys46, Lys70, Arg208, Lys209, and Lys210 residues of Gi are important for binding to human Ngb. PMID: 27109834
Ngb-H64Q-CCC binds CO about 500 times more strongly than hemoglobin, which could be useful in detecting and eliminating carbon monoxide poisoning PMID: 27928027
these results highlight the involvement of ERa activation and of E2/ERa-dependent NGB upregulation in the insensitivity of MCF-7 to paclitaxel. These novel findings could have important implications in the development of targeted therapeutics for overcoming paclitaxel insensitivity in ERa-positive human breast cancer PMID: 27312786
Knockdown of GATA-2 caused NGB expression to drop dramatically, indicating GATA-2 as an essential transcription factor for the activation of NGB expression via binding to a novel distal regulatory element of NGB. PMID: 27651453
analysis of how the interaction of hydrogen sulfide with human neuroglobin is muted by a distal ligand PMID: 28246171
NO oxidation kinetics at physiological NO concentrations. The use of a polarized electrode to efficiently interconvert the ferric (Fe(3+)) and ferrous (Fe(2+)) forms of an immobilized NGB showed that the disulfide bridge both defines the kinetics of NO dioxygenase activity and regulates appearance of the free ferrous deoxy-NGB, which is the redox active form of the protein in contrast to oxy-NGB. PMID: 27402851
Taken together, this work support the first evidence that Ngb can be potentially used as a promising biomarker and target for novel treatment of human glioma PMID: 28103511
The cochlear nuclei and superior olivary complex (SOC) also express considerable amounts of Ngb. Within the human SOC, many medial superior olive neurons, and scattered neurons in the LSO, were Ngb-immunoreactive PMID: 25636685
Study characterized the presence of Ngb in the human cochlea PMID: 26556771
Findings suggest a control model for neuroglobin's anti-apoptotic activity under physiological conditions. While in normoxic conditions, its activity is maintained at low level, an immediate transition to an hypoxic situation increases it drastically. PMID: 26305249
The review summarizes the recent experimental findings, mainly focusing on the mechanisms of Ngb's protection and induction during ischemic/hypoxic conditions and it roles in astrocytes, tumors, as well as in neurite outgrowth. [review] PMID: 25372753
Neuroglobin player role in estrogen receptor alpha-positive cancer cell viability. PMID: 25299774
a mechanism for redox control of human Ngb (hNgb) activity PMID: 24855999
17beta-estradiol-induced NGB up-regulation could act as an oxidative stress sensor, which does not oppose to the pro-apoptotic 17beta-estradiol effect in ER beta-containing colon cancer cells unless a rise of oxidative stress occurs. PMID: 25683270
first X-ray structure of wild-type human neuroglobin is reported at 1.74 A resolution PMID: 24699645
Glu60 of human Ngb is a crucial residue for its GDI and neuroprotective activities PMID: 24376733
Data show that chimeric neuroglobin and myoglobin were generated by swapping a regulatory segment. PMID: 25452214
This paper for the first time presents the data on neuroglobin distribution in human cerbellum using immunohistochemistry. PMID: 25552092
Findings indicate that myoglobin (Mb) and neuroglobin (Ngb) can be expressed in nonmuscle and non-neural contexts. PMID: 24446190
analysis of single nucleotide polymorphisms in neuroglobin that affect transcription and possibly Alzheimer's Disease PMID: 24362753
Neuroglobin brain levels are increased in Alzheimer's disease patients compared to controls. PMID: 23648513
These findings suggest that neuroglobin is expressed early in the course of neuronal differentiation and may, therefore, have a role in neurodevelopment. PMID: 23643985
NGB is expressed in the carotid body of heroin addicts and may have a role in compensating for the negative effects of heroin PMID: 23319379
Ngb and Cygb are expressed in the solitary tract nucleus and in the carotid body, and may have roles in the processing of cardiovascular and respiratory reflex inputs PMID: 23835959
Report neuroglobin expression in human brain. PMID: 23160832
functional impact of heme disorder and cysteine oxidation state on the properties of the Ngb ligand PMID: 23135388
the oxidative stress-induced structural changes of human Ngb are essential for its neuroprotective activity. PMID: 22787149
We found that NGB was present in a rat astrocytoma cell line (C6), human astrocytoma cell line (U251), and human astrocytoma tissues PMID: 22009023
overexpression in non-small cell lung cancer is associated with histological subtype, hypoxia PMID: 21601304
14-3-3 binding and phosphorylation of neuroglobin during hypoxia modulate six-to-five heme pocket coordination and rate of nitrite reduction to nitric oxide PMID: 21965683
The phenylalanine B10 residue of neuroglobin plays a key role in transmitting the structural information from the disulfide bridge to the heme-pocket region. PMID: 21704585
This review describes the discovery of neuroglobin over a decade ago, its structure, affinity for oxygen, and its expression in cerebral neurons, all of which suggest it plays a role in providing oxygen to the brain. PMID: 21620833
Caenorhabditis elegans globin GLB-26 (expressed from gene T22C1.2) has been studied in comparison with human neuroglobin (Ngb) and cytoglobin (Cygb) for its electron transfer properties PMID: 21674044
This study demonistrated that Neuroglobin overexpression in brain with arteriovenous malformation and intracerebral hemorrhage. PMID: 21725774
Cimeric Myoglobin has a cell-membrane-penetrating activity similar to zebrafish Ngb. PMID: 21304818
Data suggest a potential role of DNA methylation in regulating NGB tissue-specific expression. PMID: 21362510
neuroglobin may function as a physiological oxidative stress sensor and a post-translationally redox-regulated nitrite reductase that generates NO under six-to-five-coordinate heme pocket control PMID: 21296891
There is a plausible central role for neuroglobin in the control of apoptosis. PMID: 21190290
A significant association was found between Alzheimer disease risk and a variant in the NGB gene. Data is consistent with a model where women, older individuals and carriers of specific genotypes have lower levels of NGB leading to increased risk for AD. PMID: 19010568
Ngb may confer protection against ischemia-reperfusion injury in the brain through its intrinsic antioxidant properties. PMID: 20571522
These data favor the hypothesis that the disulfide bond between Cys46 and Cys55 modulates the functioning of human neuroglobin. PMID: 20643048
the haplotype block represented by rs3783988 in neuroglobin appears to influence recovery after severe traumatic brain injury PMID: 20345238
These data provides an explanation the action of neuroglobin in the protection of nerve cells from unwanted apoptosis. PMID: 20091232
The acid-induced denaturation pathway of apo-Ngb can be illustrated from the native state (N), via a partially unfolded state (U(A)) to the molten globule state (MG). PMID: 20227336
Ischemic stroke increases the expresssion of the neuroprotective protein neuroglobin in brain. PMID: 20075359
The conformational and functional stability of Ngb at acidic pH was analyzed. PMID: 19860834
Full-length cDNA cloning and genomic organization of NGB have been reported. PMID: 11820779

Hide All

Subcellular Location

Perikaryon. Cytoplasm. Mitochondrion.

Protein Families

Globin family

Tissue Specificity

Predominantly expressed in brain, the strongest expression is seen in the frontal lobe, the subthalamic nucleus and the thalamus.

Database Links

HGNC: 14077

OMIM: 605304

KEGG: hsa:58157

STRING: 9606.ENSP00000298352

UniGene: Hs.274363

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP015776HU
Abbreviation	Recombinant Human NGB protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Neuroglobin (NGB)

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage