Recombinant Human Neuronal acetylcholine receptor subunit alpha-7 (CHRNA7), partial, Biotinylated

Code CSB-EP005393HU-B
Abbreviation Recombinant Human CHRNA7 protein, partial, Biotinylated
MSDS
Size $472
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-230aa
Target Protein Sequence
GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
72.2 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The channel is blocked by alpha-bungarotoxin.
Gene References into Functions
  1. This report describes the development and validation of a high-throughput, genome-wide cDNA screening platform coupled to FLIPR functional assays in order to identify functional modulators of alpha7nAChR signaling PMID: 27789755
  2. alpha7 nAChR may play an important role in neuropathology caused by gp120. PMID: 28074940
  3. These findings demonstrate that a7nAChR plays an important role in H1299 cell proliferation, tumor growth and expression of vimentin. Therefore, blocking a7nAChRs in non-small cell lung cancer (NSCLC) may be a potential adjuvant therapy for the targeted treatment of NSCLC PMID: 29039603
  4. Results revealed that alpha7nAChR expressed in tumor-associated macrophages may play an important role in preventing metastasis through the JAK2/STAT3 signaling pathway and could be a prognosis marker in colorectal cancer. PMID: 28901507
  5. Study found no significant association was between CHRNA7 and vascular dementia. PMID: 27249957
  6. CHRNA7 regulates osteoclast differentiation during physiological root resorption. PMID: 28494644
  7. This study found the rs6494223 TC genotype within CHRNA7 increasing the risk for Bipolar Disorder. PMID: 28494468
  8. these results indicate that nicotine induces non-small cell lung cancer cell invasion, migration, and epithelial to mesenchymal transition ; the effects are mediated by alpha7-nAChRs and involve MEK/ERK signaling pathway PMID: 27409670
  9. This study describes screening methodology for identifying bioactive compounds in mixtures acting on the alpha7-nAChR. The methodology developed combines liquid chromatography (LC) coupled via a split with both an at-line calcium (Ca(2+))-flux assay and high-resolution mass spectrometry (MS) PMID: 26738519
  10. The authors propose a mechanism for the pathogenicity of CHRNA7 duplications of increased alpha7 Nicotinic Acetylcholine Receptor protein levels in the Endoplasmic Reticulum, resulting in Endoplasmic Reticulum stress and impaired chaperoning of alpha7 Nicotinic Acetylcholine Receptor subunits to the membrane. PMID: 29129316
  11. Immunopositivity of alpha7-nAChR in granular layers was observed in most of the fetuses and infants in the control group (83%) and several victims of the SIUDS or SIDS groups (38% and 31%, respectively). On the contrary, low levels or total absence of alpha7-nAChR immunoexpression were detected in a wide subset (over 50% of the cases) of sudden fetal and infant deaths, which was highly related to maternal smoking. PMID: 28735558
  12. alpha7nAChR activation inhibits the development of endometriosis by regulating inflammation. PMID: 27766701
  13. level of alpha7 nAChR expression in the brain is critical for supporting the resistance to inflammatory and apoptogenic agents; the data presented may be a basis to create a new strategy for preventing and, possibly, slowing Alzheimer's disease development in humans PMID: 26818865
  14. Activated alpha7nAChR exhibits extensive anti-inflammatory and immune modulatory reactions, including lowered pro-inflammatory cytokines levels, decreased expressions of chemokines as well as adhesion molecules, and altered differentiation and activation of immune cells, which are important in maintaining immune homeostasis. PMID: 28123345
  15. Comprehensive phenotyping revealed high prevalence of developmental delay/intellectual disability, autism spectrum disorder, and attention deficit/hyperactivity disorder in children with microduplications involving CHRNA7. PMID: 27853923
  16. These results support our previous study showing that these PAMs are selective for the alpha7 AChR, and clarify that the procognitive/promnesic/antidepressant activity of PAM-2 is not mediated by other targets. PMID: 27129924
  17. Data (including data from studies conducted using knockout mice and SH-SY5Y cell line) suggest that Wnt/beta-catenin signaling is critical effector of CHRNA7-associated neuroprotection of dopaminergic neurons in substantia nigra; Parkinson's disease appears to develop without this neuroprotection. PMID: 28551099
  18. Treatment of cells with nicotine induced the mRNA and protein levels of alpha7 nAChR; this could be abrogated by treatment with inhibitors targeting Src, PI3K, MEK, alpha7 nAChR, CDK4/6 or a disruptor of the Rb-Raf-1 interaction. PMID: 27228072
  19. Study provides novel information on alpha7 potentiation: results show that positive allosteric modulators enhance open-channel lifetime and produce episodes of successive openings, thus indicating that both types affect alpha7 kinetics. Different positive allosteric modulators types show different sensitivity to temperature, suggesting different mechanisms of potentiation. PMID: 26926428
  20. Activation of alpha7nAChR alleviates Ang II-induced vascular smooth muscle cell senescence by promoting NAD(+)-SIRT1 pathway. PMID: 27339462
  21. We assume an additive effect of haploinsufficiency of ZBTB18 and CHRNA7 in our patient. Assembling the features of our patient and the published patients, we noted that only one of them showed mild anomalies of the corpus callosum. PMID: 28345786
  22. the purified alpha7nAChR injected into Xenopus oocytes can be activated by acetylcholine, choline, and nicotine, inhibited by the channel blockers QX-222 and phencyclidine, and potentiated by the alpha7nAChR specific modulators PNU-120596 and TQS. PMID: 27385587
  23. results demonstrate the anti-inflammatory role of alpha7 nAChR in NK cells and suggest that modulation of its activity in these cells may constitute a novel target for regulation of the immune response. PMID: 27284006
  24. The current review summarizes information on receptor expression, the intracellular signaling pathways they modulate and reasons for receptor dysfunction. [review] PMID: 26979166
  25. A7-nAChR may be a key biomarker for assessing the chemosensitivity of gastric cancer cells to taxane. PMID: 26499946
  26. Gene expression levels of alpha7nAChR did not differ between groups; protein expression was significantly higher in chronic rhinosinusitis with nasal polyps than in chronic rhinosinusitis without nasal polyps, and both of these patient groups showed significant higher levels than controls. PMID: 26410356
  27. Data also suggest that alpha7 nicotinic acetylcholine receptor (alpha7-nAChR) inhibition or targeting Snail may provide a feasible rationale for preventing the progression of HNSCC. PMID: 24986226
  28. This review discusses the current literature on stroke-induced inflammation and the effects of CHRNA7 modulators on innate immune cells.[Review] PMID: 26690125
  29. Promoter variant -194C (rs28531779) was significantly associated with schizophrenia, but not associated with P50 suppression or pre-pulse inhibition of the startle reflex. CHRNA7 promoter variants had elevated startle magnitude in pulse-alone trials. PMID: 26376812
  30. A stronger alpha7nAChR immunoreactivity than seen for tenocytes was observed for the cells in the peritendinous tissue. PMID: 25981114
  31. The purified alpha 7-nicotinic acetylcholine receptor samples displayed high thermal stability with a Tm of 60 degrees C. PMID: 26073323
  32. This supports the hypothesis that the antiproliferative activity of SLURP-1 is related to 'metabotropic' signaling pathway through alpha7-nAChR, that activates intracellular signaling cascades without opening the receptor channel. PMID: 26905431
  33. expression of chaperones such as Ric-3 can influence proteins associating with alpha7-nAChRs PMID: 26258666
  34. 14 single nucleotide polymorphisms cause missense mutations of human alpha7 nicotinic receptor exert a different functional impact. PMID: 26340537
  35. It was concluded that the mechanism of alpha-bungarotoxin antagonism of CHRNA7 is non-competitive, originating from conformational arrest of the binding sites. PMID: 26282895
  36. The CNV-3956 of CHRNA7 contributed to increased risks and poor prognoses of both COPD and lung cancer, and this may be a genetic biomarker of the two diseases. PMID: 25407004
  37. The results clearly showed that depletion of A7-nAChR suppressed the drug sensitivity of gastric cancer cells to 5-FU treatment PMID: 26136123
  38. Study explored the microscopic mechanisms underlying the interplay between the channel domains and the coupling interface that affect the channel activity, and generated an allosteric gating model for CHRNA7 PMID: 25908400
  39. Data show preferential fetal CHRFAM7A expression in the human prefrontal cortex and suggest abnormalities in the CHRFAM7A/CHRNA7 ratios in schizophrenia and bipolar disorder, due mainly to overexpression of CHRFAM7A. PMID: 26206074
  40. CHRNA7 variants may not contribute to autism spectrum disorder susceptibility. PMID: 25655306
  41. analysis of different allosteric binding sites in the alpha7 nAChR PMID: 25918415
  42. a7 nicotinic acetylcholine receptor signaling inhibits NLRP3 inflammasome activation by preventing mitochondrial DNA release PMID: 24849809
  43. Our findings suggest that alpha7nAChR and MAPK signaling pathways play an important role in the uptake and accumulation of Abeta1-42 in SH-SY5Y cells. PMID: 25168732
  44. There is an association between the CHRNA7 T allele and a better response to treatment with cholinesterase inhibitors in patients with mild AD. PMID: 24951635
  45. However,[CHRNA7 promoter variant] -86T was significantly more frequent among patients with OCD (TS/OCD and TS/OCD/ADHD) compared to patients without OCD (TS-only and TS/ADHD) PMID: 25024057
  46. Activation of CHRNA7 by nicotine reduced the Th17 response in CD4 positive T lymphocytes PMID: 24949556
  47. Vagus nerve through alpha7 nAChR modulates lung infection and inflammation: models, cells, and signals. PMID: 25136575
  48. This study reveals that alpha7 nicotinic acetylcholine receptor gene expression levels in peripheral blood mononuclear cells is a clinically relevant marker for cholinergic antiinflammatory pathway activity and clinical outcome in sepsis. PMID: 25092899
  49. alpha7nAChR protein was detected on T cells and macrophages in surgical specimens of atherosclerotic plaques. PMID: 25324572
  50. CHRNA17 triplication co-segregates with neuropsychiatric and cognitive phenotypes in three-generation pedigree. PMID: 24424125

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-7/CHRNA7 sub-subfamily
Database Links

HGNC: 1960

OMIM: 118511

KEGG: hsa:1139

UniGene: Hs.510853

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*