Home
Protein
Recombinant Proteins
Recombinant Human Non-structural maintenance of chromosomes element 3 homolog (NSMCE3)

Recombinant Human Non-structural maintenance of chromosomes element 3 homolog (NSMCE3)

^{In Stock}

Code	CSB-EP856984HU
Abbreviation	Recombinant Human NSMCE3 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

NSMCE3

Uniprot No.

Q96MG7

Research Area

Others

Alternative Names

Hepatocellular carcinoma-associated protein 4 MAGE-G1 antigen Melanoma-associated antigen G1 Necdin-like protein 2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-304aa

Target Protein Sequence

MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

38.4 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In e.coli cells, the generation of the recombinant Human NSMCE3 protein includes integrating a DNA fragment encoding the Human NSMCE3 protein (1-304aa) into a plasmid vector and transforming this vector into e.coli cells. Cells containing the plasmid are screened, cultured, and induced to yield the NSMCE3 protein. A N-terminal 6xHis tag is attached to the protein. Lysis of the cells facilitates the collection of the recombinant Human NSMCE3 protein, which is subjected to affinity purification and then SDS-PAGE analysis and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the obtained recombinant Human NSMCE3 protein is greater than 85%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). In vitro enhances ubiquitin ligase activity of NSMCE1. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May be a growth suppressor that facilitates the entry of the cell into cell cycle arrest.

Gene References into Functions

NSMCE3 (also known as NDNL2) gene encodes a subunit of the SMC5/6 complex that is essential for DNA damage response and chromosome segregation PMID: 27427983
gene expression, imprinting, and chromosome mapping of NDNL2 PMID: 11782285
The four non-SMC components of the human complex were identified and characterized and it was demonstrated that the MAGEG1 protein is part of this complex. PMID: 18086888

Involvement in disease

Lung disease, immunodeficiency, and chromosome breakage syndrome (LICS)

Subcellular Location

Cytoplasm. Nucleus. Chromosome, telomere.

Tissue Specificity

Ubiquitous.

Database Links

HGNC: 7677

OMIM: 608243

KEGG: hsa:56160

STRING: 9606.ENSP00000330694

UniGene: Hs.94011