Recombinant Human Nuclear inhibitor of protein phosphatase 1 (PPP1R8)

Code CSB-YP618641HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP618641HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP618641HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP618641HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PPP1R8
Uniprot No.
Alternative Names
Activator of RNA decay; ARD 1; ARD-1; ARD1; Homolog of E.coli RNase E; NIPP 1; NIPP-1; NIPP1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; Nuclear subunit of PP1; PP1R8_HUMAN; PPP1R8; PRO2047 ; Protein phosphatase 1 regulatory inhibitor subunit 8; Protein phosphatase 1 regulatory subunit 8; RNase E; RNase E, E. coli, homolog of
Species
Homo sapiens (Human)
Expression Region
1-209
Target Protein Sequence
MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG
Protein Length
full length of Isoform 2
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.; Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.
Gene References into Functions
  1. NIPP1 could be activated by hypoxia and contributed to hypoxia-induced invasive and metastatic potential in hepatocellular carcinoma. PMID: 27644248
  2. Data suggest overexpression of NIPP1 in HeLa cells causes induction of genes of mesenchymal lineage with reduction in cell proliferation; thus, key dephosphorylation events may be involved in epithelial-mesenchymal transition or transdifferentiation. PMID: 25907536
  3. The protein phosphatase-1 regulator NIPP1 is also a splicing factor involved in a late step of spliceosome assembly PMID: 11909864
  4. NIPP1 has a role in the nuclear targeting and/or retention of PP1 PMID: 15501817
  5. Required for the global trimethylation of histone3 at lysine27 and is implicated in gene silencing by enhancer of zeste homolog (EZH)2. PMID: 17724462
  6. NIPP1 is present in a complex with EED and EZH2 in vivo and has distinct binding sites for these proteins. PMID: 17804093
  7. NMR structure of the NIPP1 FHA domain. PMID: 18253837
  8. NIPP1 works as a molecular sensor for PP1 to recognize phosphorylated Sap155. PMID: 18842582

Show More

Hide All

Subcellular Location
Nucleus. Nucleus speckle. Note=Primarily, but not exclusively, nuclear.; [Isoform Gamma]: Cytoplasm. Note=Found mainly in the cytoplasm.
Tissue Specificity
Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform
Database Links

HGNC: 9296

OMIM: 602636

KEGG: hsa:5511

STRING: 9606.ENSP00000311677

UniGene: Hs.533474

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×