Recombinant Human Nuclear transport factor 2(NUTF2)

Code CSB-EP016214HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P61970
Relevance Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Placental protein 15
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Research Area Signal Transduction
Source E.coli
Gene Names NUTF2
Protein Names Recommended name: Nuclear transport factor 2 Short name= NTF-2 Alternative name(s): Placental protein 15 Short name= PP15
Expression Region 1-127aa
Tag Info N-terminal GST-tagged
Mol. Weight 41.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.
Subcellular Location Cytoplasm, cytosol, Nucleus outer membrane, Nucleus, nuclear pore complex, Nucleus inner membrane, Nucleus, nucleoplasm
Database Links

HGNC: 13722

OMIM: 605813

KEGG: hsa:10204

STRING: 9606.ENSP00000219169

UniGene: Hs.356630

Related Products

NUTF2 Antibodies

NUTF2 Antibodies for Homo sapiens (Human)

NUTF2 Antibodies for Human

NUTF2 Proteins

NUTF2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.