Recombinant Human Oligoribonuclease, mitochondrial (REXO2)

Code CSB-YP446358HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP446358HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP446358HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP446358HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP446358HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Oligoribonuclease, mitochondrial; EC 3.1.15.-; RNA exonuclease 2 homolog; Small fragment nuclease; REXO2 SFN SMFN CGI-114
Species
Homo sapiens (Human)
Expression Region
26-237
Target Protein Sequence
VREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
3'-to-5'exoribonuclease that preferentially degrades DNA and RNA oligonucleotides composed of only two nucleotides. Binds and degrades longer oligonucleotides with a lower affinity. Plays dual roles in mitochondria, scavenging nanoRNAs (small RNA oligonucleotides of <5 nucleotides) that are produced by the degradosome and clearing short RNAs that are generated by RNA processing. Essential for correct initiation of mitochondrial transcription, degrading mitochondrial RNA dinucleotides to prevent RNA-primed transcription at non-canonical sites in the mitochondrial genome. Essential for embryonic development.; 3'-to-5'exoribonuclease that preferentially degrades DNA and RNA oligonucleotides composed of only two nucleotides.
Gene References into Functions
  1. results demonstrate that 14-3-3sigma induces cisplatin resistance in esophageal squamous cell carcinoma cells PMID: 26346170
  2. CBY1 downregulation in CML arises from reduced protein stability upon binding to 14-3-3sigma adapter protein. The ubiquitin proteasome system UPS participates in reducing stability of CBY1 bound with 14-3-3sigma through enhanced SUMOylation. PMID: 26147002
  3. Loss of 14-3-3sigma sensitizes cells to UVB. After a transient cell cycle arrest, 14-3-3sigma-deficient cells die by undergoing mitotic catastrophe. PMID: 24102700
  4. REXO2 is an oligoribonuclease active in human mitochondria and present both in cytosolic and mitochondrial fractions. PMID: 23741365
  5. SFN expression is involved in resistance of RSa cells to UV-C-induced cell death through the roles it plays in the DNA repair process PMID: 15362935
  6. The expression in E. coli of orn and homologues from Mycobacterium smegmatis and human, and large-scale purification of the three enzymes, is reported. PMID: 18023590

Show More

Hide All

Subcellular Location
Mitochondrion intermembrane space. Mitochondrion matrix. Mitochondrion. Cytoplasm. Nucleus.; [Isoform 3]: Cytoplasm. Nucleus.
Protein Families
Oligoribonuclease family
Tissue Specificity
Highly expressed in the heart and at lower levels in the lymph nodes, brain, lung, liver, spleen and thymus.
Database Links

HGNC: 17851

OMIM: 607149

KEGG: hsa:25996

STRING: 9606.ENSP00000265881

UniGene: Hs.677190

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1