Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

OSMR

Uniprot No.

Q99650

Research Area

Immunology

Alternative Names

Interleukin-31 receptor subunit beta

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

762-979aa

Target Protein Sequence

KSQWIKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.3 kDa

Protein Length

partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In e.coli cells, the generation of the recombinant Human OSMR protein includes integrating a DNA fragment encoding the Human OSMR protein (762-979aa) into a plasmid vector and transforming this vector into e.coli cells. Cells containing the plasmid are screened, cultured, and induced to yield the OSMR protein. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Lysis of the cells facilitates the collection of the recombinant Human OSMR protein, which is subjected to affinity purification and then SDS-PAGE analysis and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the obtained recombinant Human OSMR protein is greater than 85%.

Target Background

Function

Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.

Gene References into Functions

Polymorphisms of the OSMR rs2292016 locus are related to the development and outcome of DCM. PMID: 29652994
Missense mutatios were found in exon 10 of the oncostatin-M specific receptor beta subunit (OSMR) gene in all of the six patients from family 1, and in exon 14 of the OSMR gene in all of the four patients from family 2. PMID: 29419851
The PLAC1 expression has been demonstrated for the first time in cervical cancers. This preliminary study has further revealed a complex relationship between PLAC1 expression, cervical cancer histologic type, p53, and HPV type that requires further investigation. PMID: 28375929
OSMR-beta deficiency in macrophages improved high-fat diet-induced atherogenesis and plaque vulnerability PMID: 28258089
OSM and OSMR are highly expressed in inflammatory bowel disease intestinal mucosa compared to control mucosa. Intestinal stromal cells express abundant OSMR. PMID: 28368383
OSM:OSMR interactions are able to induce EMT, increased cancer stem cell-like properties and enhanced lung colonisation in SCC cells PMID: 27351213
the RET p.S891A mutation combined with OSMR p.G513D may underlie a novel phenotype manifesting as familial medullary thyroid carcinoma and cutaneous amyloidosis PMID: 26356818
this study offers new findings on the molecular genetics and disease relevance of mutations in OSMR in Familial primary localized cutaneous amyloidosis. PMID: 25792357
Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. PMID: 26198770
OSMRBeta in neurons is critical for neuronal survival during cerebral ischemic/reperfusion. PMID: 26311783
primary localized cutaneous amyloidosis has a missense mutation in oncostatin M receptor beta PMID: 25054142
The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma. PMID: 25283844
oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells. PMID: 24418171
The disease severity of rheumatoid arthritis and systemic lupus erythematosus can be partially affected by the OSMR promoter polymorphisms. PMID: 24219225
We conclude that an OSMR/TGM2/integrin-alpha5beta1/fibronectin pathway is of biological significance in cervical squamous cell carcinoma PMID: 23765377
A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor. PMID: 22829597
enhanced production by beta-defensin-2 in T cells PMID: 22137028
This study identified a new heterozygous OSMR missense mutation in primary localized cutaneous amyloidosis. PMID: 22062952
An alternatively spliced variant of OSMR transcribing a soluble form of this receptor has been characterized in esophageal squamous cell carcinoma. PMID: 21394648
We conclude that OSMR overexpression in cervical SCC cells provides increased sensitivity to OSM, which induces pro-malignant changes. PMID: 21952923
Aberrant methylation of the OSMR gene is associated with non-invasive colorectal cancer. PMID: 21508378
Two new pathogenic heterozygous missense mutations in the OSMR gene (p.Val631Leu and p.Asp647Tyr) were identified in two Dutch familial primary localized cutaneous amyloidosis families. PMID: 20507362
study provides evidence for the existence of a novel pathogenic mutation in the OSMR gene in a caucasian family with familial primary cutaneous amyloidosis PMID: 19466957
The identification of OSMR and IL31RA gene pathology provides an explanation of the high prevalence of primary cutaneous amyloidosis in Taiwan as well as new insight into disease pathophysiology. PMID: 19690585
provides a biologic rationale for silencing of OSMR in colon cancer progression and highlight a new therapeutic target. Moreover, detection and quantification of OSMR promoter methylation in fecal DNA is a highly specific diagnostic biomarker for CRC PMID: 19662090
expression and evidence for STAT3 activation in human ovarian carcinomas PMID: 12061840
The expression of OSM and its receptor in ovarian tissue from fetuses and women suggests a possible role of OSM in growth initiation of human primordial follicles. PMID: 15831292
sOSMR is able to bind OSM and interleukin-31 when associated to soluble gp130 or soluble interleukin-31R, respectively, and to neutralize both cytokine properties PMID: 17028186
FPLCA has been mapped to 5p13.1-q11.2, and by candidate gene analysis, study identified missense mutations in the OSMR gene, encoding oncostatin M-specific receptor beta (OSMRbeta), in three families. PMID: 18179886
murine OSMR initiates STAT5 activation directly via the receptor bound Janus kinases. Intriguingly, the murine receptor preferentially recruits JAK2, whereas the human receptor seems to have a higher affinity for JAK1. PMID: 18430728
IL-6 and Oncostatin M individually affect the profile of leukocyte trafficking PMID: 18641356
The renal parenchyma is capable of generating a strong acute phase response, likely mediated via OSM/OSMR. PMID: 19158344
Epigenetic silencing and DNA methylation of OSMR is associated with colorectal cancers. PMID: 19223499
study reporta a Japanese family with familial primary localized cutaneous amyloidosis in whom a novel OSMR mutation was observed PMID: 19375894

Hide All

Involvement in disease

Amyloidosis, primary localized cutaneous, 1 (PLCA1)

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Type I cytokine receptor family, Type 2 subfamily

Tissue Specificity

Expressed in keratinocytes (at protein level). Expressed at relatively high levels in all neural cells as well as fibroblast and epithelial cells.

Database Links

HGNC: 8507

OMIM: 105250

KEGG: hsa:9180

STRING: 9606.ENSP00000274276

UniGene: Hs.120658

Code	CSB-EP857869HU
Abbreviation	Recombinant Human OSMR protein, partial
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Oncostatin-M-specific receptor subunit beta (OSMR), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage