Recombinant Human Oncostatin-M-specific receptor subunit beta (OSMR), partial

In Stock
Code CSB-EP857869HU
Abbreviation Recombinant Human OSMR protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Interleukin-31 receptor subunit beta
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
762-979aa
Target Protein Sequence
KSQWIKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKNYMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPGEHYC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.3 kDa
Protein Length
partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

In e.coli cells, the generation of the recombinant Human OSMR protein includes integrating a DNA fragment encoding the Human OSMR protein (762-979aa) into a plasmid vector and transforming this vector into e.coli cells. Cells containing the plasmid are screened, cultured, and induced to yield the OSMR protein. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Lysis of the cells facilitates the collection of the recombinant Human OSMR protein, which is subjected to affinity purification and then SDS-PAGE analysis and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the obtained recombinant Human OSMR protein is greater than 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.
Gene References into Functions
  1. Polymorphisms of the OSMR rs2292016 locus are related to the development and outcome of DCM. PMID: 29652994
  2. Missense mutatios were found in exon 10 of the oncostatin-M specific receptor beta subunit (OSMR) gene in all of the six patients from family 1, and in exon 14 of the OSMR gene in all of the four patients from family 2. PMID: 29419851
  3. The PLAC1 expression has been demonstrated for the first time in cervical cancers. This preliminary study has further revealed a complex relationship between PLAC1 expression, cervical cancer histologic type, p53, and HPV type that requires further investigation. PMID: 28375929
  4. OSMR-beta deficiency in macrophages improved high-fat diet-induced atherogenesis and plaque vulnerability PMID: 28258089
  5. OSM and OSMR are highly expressed in inflammatory bowel disease intestinal mucosa compared to control mucosa. Intestinal stromal cells express abundant OSMR. PMID: 28368383
  6. OSM:OSMR interactions are able to induce EMT, increased cancer stem cell-like properties and enhanced lung colonisation in SCC cells PMID: 27351213
  7. the RET p.S891A mutation combined with OSMR p.G513D may underlie a novel phenotype manifesting as familial medullary thyroid carcinoma and cutaneous amyloidosis PMID: 26356818
  8. this study offers new findings on the molecular genetics and disease relevance of mutations in OSMR in Familial primary localized cutaneous amyloidosis. PMID: 25792357
  9. Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology. PMID: 26198770
  10. OSMRBeta in neurons is critical for neuronal survival during cerebral ischemic/reperfusion. PMID: 26311783
  11. primary localized cutaneous amyloidosis has a missense mutation in oncostatin M receptor beta PMID: 25054142
  12. The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma. PMID: 25283844
  13. oncostatin M is a cytokine possessing vigorous antiviral and immunostimulatory properties which is released by APC upon interaction with CD40L present on activated CD4+ T cells. PMID: 24418171
  14. The disease severity of rheumatoid arthritis and systemic lupus erythematosus can be partially affected by the OSMR promoter polymorphisms. PMID: 24219225
  15. We conclude that an OSMR/TGM2/integrin-alpha5beta1/fibronectin pathway is of biological significance in cervical squamous cell carcinoma PMID: 23765377
  16. A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor. PMID: 22829597
  17. enhanced production by beta-defensin-2 in T cells PMID: 22137028
  18. This study identified a new heterozygous OSMR missense mutation in primary localized cutaneous amyloidosis. PMID: 22062952
  19. An alternatively spliced variant of OSMR transcribing a soluble form of this receptor has been characterized in esophageal squamous cell carcinoma. PMID: 21394648
  20. We conclude that OSMR overexpression in cervical SCC cells provides increased sensitivity to OSM, which induces pro-malignant changes. PMID: 21952923
  21. Aberrant methylation of the OSMR gene is associated with non-invasive colorectal cancer. PMID: 21508378
  22. Two new pathogenic heterozygous missense mutations in the OSMR gene (p.Val631Leu and p.Asp647Tyr) were identified in two Dutch familial primary localized cutaneous amyloidosis families. PMID: 20507362
  23. study provides evidence for the existence of a novel pathogenic mutation in the OSMR gene in a caucasian family with familial primary cutaneous amyloidosis PMID: 19466957
  24. The identification of OSMR and IL31RA gene pathology provides an explanation of the high prevalence of primary cutaneous amyloidosis in Taiwan as well as new insight into disease pathophysiology. PMID: 19690585
  25. provides a biologic rationale for silencing of OSMR in colon cancer progression and highlight a new therapeutic target. Moreover, detection and quantification of OSMR promoter methylation in fecal DNA is a highly specific diagnostic biomarker for CRC PMID: 19662090
  26. expression and evidence for STAT3 activation in human ovarian carcinomas PMID: 12061840
  27. The expression of OSM and its receptor in ovarian tissue from fetuses and women suggests a possible role of OSM in growth initiation of human primordial follicles. PMID: 15831292
  28. sOSMR is able to bind OSM and interleukin-31 when associated to soluble gp130 or soluble interleukin-31R, respectively, and to neutralize both cytokine properties PMID: 17028186
  29. FPLCA has been mapped to 5p13.1-q11.2, and by candidate gene analysis, study identified missense mutations in the OSMR gene, encoding oncostatin M-specific receptor beta (OSMRbeta), in three families. PMID: 18179886
  30. murine OSMR initiates STAT5 activation directly via the receptor bound Janus kinases. Intriguingly, the murine receptor preferentially recruits JAK2, whereas the human receptor seems to have a higher affinity for JAK1. PMID: 18430728
  31. IL-6 and Oncostatin M individually affect the profile of leukocyte trafficking PMID: 18641356
  32. The renal parenchyma is capable of generating a strong acute phase response, likely mediated via OSM/OSMR. PMID: 19158344
  33. Epigenetic silencing and DNA methylation of OSMR is associated with colorectal cancers. PMID: 19223499
  34. study reporta a Japanese family with familial primary localized cutaneous amyloidosis in whom a novel OSMR mutation was observed PMID: 19375894

Show More

Hide All

Involvement in disease
Amyloidosis, primary localized cutaneous, 1 (PLCA1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type I cytokine receptor family, Type 2 subfamily
Tissue Specificity
Expressed in keratinocytes (at protein level). Expressed at relatively high levels in all neural cells as well as fibroblast and epithelial cells.
Database Links

HGNC: 8507

OMIM: 105250

KEGG: hsa:9180

STRING: 9606.ENSP00000274276

UniGene: Hs.120658

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*