Home
Protein
Recombinant Proteins
Recombinant Human PRELI domain containing protein 3B (PRELID3B)

Recombinant Human PRELI domain containing protein 3B (PRELID3B)

^{In Stock}

Code	CSB-BP896708HU
Abbreviation	Recombinant Human PRELID3B protein
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. The purity of PRELID3B was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.

Target Names

PRELID3B

Uniprot No.

Q9Y3B1

Research Area

Others

Alternative Names

Protein slowmo homolog 2

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1-194aa

Target Protein Sequence

MKIWTSEHVFDHPWETVTTAAMQKYPNPMNPSVVGVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVVDPVEKTMELKSTNISFTNMVSVDERLIYKPHPQDPEKTVLTQEAIITVKGVSLSSYLEGLMASTISSNASKGREAMEWVIHKLNAEIEELTASARGTIRTPMAAAAFAEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.1 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the potential of our Recombinant Human PRELID3B, a versatile research tool designed for the study of PRELI domain containing protein 3B (Protein slowmo homolog 2). This protein plays a crucial role in mitochondrial lipid homeostasis, making it an important target for further understanding the intricate molecular mechanisms involved in cellular function.

Our Recombinant Human PRELID3B is expressed in a Baculovirus system and features the full length of the protein (1-194aa), providing an accurate representation for your research needs. The C-terminal 6xHis tag enables effortless purification and detection of the protein. With a purity greater than 85% as determined by SDS-PAGE, this high-quality recombinant protein is available in both liquid and lyophilized powder forms, ensuring flexibility and reliability for your experimental requirements.