Recombinant Human PRKCA-binding protein (PICK1), partial

Code CSB-RP054454h
Abbreviation Recombinant Human PICK1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
dJ1039K5; MGC15204; OTTHUMP00000028509; PICK 1; Pick1; PICK1_HUMAN; PRKCA binding protein; PRKCA-binding protein; PRKCABP; Protein interacting with C kinase 1; Protein interacting with PRKCA; Protein interacting with PRKCA 1; Protein kinase C alpha binding protein; Protein kinase C-alpha-binding protein; Protein that interacts with C kinase 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-200aa
Target Protein Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.9kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function.
Gene References into Functions
  1. this is the first study to indicate that PICK1 polymorphisms may associate with cognitive functions in schizophrenic patients. PMID: 28507309
  2. Coincident with the loss of PICK1 by GBF1-activated ARF1, CDC42 recruitment leads to the activation of IRSp53 and the ARP2/3 complex, resulting in a burst of F-actin polymerisation potentially powering scission. PMID: 29743604
  3. PICK1 is a cargo-specific endocytic accessory protein required for efficient, activity-dependent AMPAR endocytosis. PMID: 28855251
  4. Our results demonstrate that downregulation of PICK1 elicited by miR-210-3p overexpression activates the TGF-b pathway, which further promotes bone metastasis in PCa, indicating that the miR- 210-3p/PICK1/TGF-b signalling axis plays an important role in PCa bone metastasis. PMID: 28697177
  5. This study defines a novel mechanism whereby elevated [Ca(2+)] induced by NMDA receptor activation modulates Ago2 and miRNA activity via PICK1. Our work suggests a Ca(2+)-dependent process to regulate miRNA activity in neurons in response to the induction of long-term depression. PMID: 28404816
  6. We propose that PICK1 negatively regulates neoplastic infiltration of astrocytic tumors and that manipulation of PICK1 is an attractive possibility for therapeutic intervention PMID: 26466675
  7. PICK1 domain ACT links PICK1-associated vesicles to a motility factor, likely myosin, but, contrary to previous reports, PICK1 neither binds nor inhibits Arp2/3 complex. PMID: 25657323
  8. Unlike accessory domains in other BAR domain proteins, the positioning of the PDZ domains is flexible, enabling PICK1 to perform long-range, dynamic scaffolding of membrane-associated proteins. PMID: 26073603
  9. Data indicate three principal binding modes can account for protein interacting with C-kinase 1 (PICK1) PDZ domains binding specificity. PMID: 25023278
  10. PICK1 promotes Ago2 localization at endosomal compartments in neuronal dendrites and inhibits Ago2 function in translational repression following neuronal stimulation. PMID: 24723684
  11. These data indicate that Pick1 is involved in regulating the cell-cell junction in epithelial cells. PMID: 24937449
  12. C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKCalpha complex and cerebellar plasticity. PMID: 24358315
  13. Family-based association study failed to observe a statistically significant association for any of the genotyped SNPs in the PICK1 gene and attention-deficit hyperactivity disorder. PMID: 22436349
  14. PICK1 increases caveolin-mediated endocytosis, ubiquitination and degradation of TGF-beta type I receptor. PMID: 22710801
  15. The binding affinities of all major PICK1 interacting proteins are reported and the effects of PICK1 mutations on these interactions are described. PMID: 22275068
  16. PICK1 is a suppressor of spinocerebellar ataxia 3-associated neurodegeneration. PMID: 21949352
  17. Neph proteins and PICK1 synergistically regulate cell recognition and contact formation; Binding required dimerization of PICK1, was dependent on PDZ domain protein interactions, and mediated stabilization of Neph1 at the plasma membrane. PMID: 21690291
  18. we have identified a homozygous mutation in the PICK1 gene that is associated with globozoospermia in humans PMID: 20562896
  19. The PICK1 mRNA is elevated in patient with schizophrenia. PMID: 20385472
  20. Protein interacting with C alpha kinase 1 (PICK1) is involved in promoting tumor growth and correlates with poor prognosis of human breast cancer. PMID: 20384629
  21. Results describe the first small-molecule inhibitor (FSC231) of the PDZ domain in PICK1, which binds the PICK1 PDZ domain with an affinity similar to that observed for endogenous peptide ligands. PMID: 20018661
  22. binding with glutamate receptor subtype PMID: 11891216
  23. The PICK1 rs3952 polymorphism was genotyped in schizophrenia and controls. Results demonstrated that the PICK1 rs3952 genotype and allele distribution was significantly different between the two groups. PMID: 15305146
  24. PICK-1 could be involved in the regulation of both adherens and tight junctions in epithelial cells PMID: 15811349
  25. In a case-control association study, an association of the PICK1 gene with schizophrenia (SZ) was seen, which is more prominent in disorganized SZ. Findings implicating PICK1 are consistent with a role for D-serine in the disease. PMID: 16314870
  26. polymorphisms of the PICK1 gene identified thus far are unlikely to contribute to genetic susceptibility to schizophrenia in the Japanese population PMID: 17367885
  27. findings suggest that the PICK1 gene may be implicated in the susceptibility to spontaneous relapse of methamphetamine psychosis and that, as an intracellular adapter protein, PICK1 may play a role in the pathophysiology of methamphetamine psycho PMID: 17606663
  28. PICK1 synaptic targeting requires direct interaction between the PDZ domain and lipid membranes PMID: 17914463
  29. KRIP6 regulates kainate receptors by inhibiting PICK1 modulation via competition or a mutual blocking effect PMID: 18692513

Show More

Hide All

Subcellular Location
Cytoplasm, perinuclear region. Membrane; Peripheral membrane protein. Membrane; Lipid-anchor. Cell junction, synapse, postsynaptic density. Cell junction, synapse, synaptosome. Cytoplasm, cytoskeleton.
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 9394

OMIM: 605926

KEGG: hsa:9463

STRING: 9606.ENSP00000349465

UniGene: Hs.180871

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*