Recombinant Human Pappalysin-1 (PAPPA), partial

Code CSB-YP621656HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP621656HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP621656HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP621656HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP621656HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PAPPA
Uniprot No.
Alternative Names
Pappalysin-1; EC 3.4.24.79; Insulin-like growth factor-dependent IGF-binding protein 4 protease; IGF-dependent IGFBP-4 protease; IGFBP-4ase; Pregnancy-associated plasma protein A; PAPP-A; PAPPA
Species
Homo sapiens (Human)
Expression Region
1476-1556
Target Protein Sequence
GQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVK
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Metalloproteinase which specifically cleaves IGFBP-4 and IGFBP-5, resulting in release of bound IGF. Cleavage of IGFBP-4 is dramatically enhanced by the presence of IGF, whereas cleavage of IGFBP-5 is slightly inhibited by the presence of IGF.
Gene References into Functions
  1. Serum PAPP-A at third trimester of pregnancy was not associated with late-onset pre-eclampsia and intrauterine growth retardation after 34weeks of pregnancy. PMID: 29674192
  2. Elevated PROK1 in the first pregnancy trimester is a more effective marker than PAPP-A in the prediction of pre-eclampsia and fetal growth restriction. PMID: 28675948
  3. The findings suggest a possible pathophysiological link between the development of Fetal growth restriction and the expression of PAPPA, PAPPA2 and PLAC-1. PMID: 29532882
  4. Data suggest that PGF and PAPPA serve as serum biomarkers for early diagnosis of gestational hypertension. These studies were conducted at antenatal clinics in Ghana using blood from women between 8 and 13 weeks gestation. (PGF = placental growth factor; PAPPA = pregnancy-associated plasma protein-A) PMID: 29587776
  5. Pregnancy associated plasma protein-A (PAPP-A) appears to be a potentially useful biomarker for short-term risk stratification of patients presenting with chest pain of ischemic origin (Review). PMID: 29144175
  6. These data suggested that hsa_circ_0004904 and hsa_circ_0001855 combined with PAPP-A might be promising biomarkers for the detection of Preeclampsia. Bioinformatics analysis predicted that hsa_circ_0004904 and hsa_circ_0001855 miRNA sponges directly target PAPP-A. PMID: 29758559
  7. higher first trimester serum values seem to be associated with placenta accreta in women with placenta previa PMID: 28027672
  8. Studied the role of pregnancy-associated plasma protein A (PAPP-A) in the outcome of ischemic cerebrovascular disease. PMID: 27809366
  9. maternal serum levels associated with small for gestational age neonates, preterm birth, and pre-eclampsia PMID: 28514830
  10. PAPP-A and ProMBP are associated with increased risk of death in heart failure patients. PMID: 28537443
  11. low levels not associated with high serum estradiol at controlled ovarian stimulation PMID: 28606451
  12. PAPP-A C/C genotypes were more frequent among mothers with gestational diabetes than in control. PMID: 28655969
  13. Elevated PAPP-A compared to other risk factors was a stronger predictor for future CV events 2 years post ACS in patients with type 2 diabetes mellitus. PMID: 28381225
  14. PAPP-A, like CCS and CIMT, is a parameter that can be used to detect subclinical atherosclerosis. PMID: 28791822
  15. Results suggest that links between PAPP-A concentrations in early pregnancy and subsequent glucose concentrations and blood pressures may be mediated by changes in insulin sensitivity (and secretion). PMID: 28323969
  16. Collectively, these results identify PAPP-A as a pregnancy-dependent oncogene while also showing that extended lactation is protective against PAPP-A-mediated carcinogenesis. PMID: 26951623
  17. Lower PlGF and higher PAPP-A and free beta-hCG levels were found in the fetal circulation of near-term severe preeclamptic pregnancies PMID: 27809614
  18. PAPP-A 1224 SNP has a significant effect on the level and activity of PAPP-A in human follicles, suggesting that the follicular fluid level of bioactive insulin-like growth factor depends on the genotype. PMID: 27793387
  19. This study demonstrated no association between PAPP-A gene rs7020782 polymorphism and Preeclampsia (PE) and intrauterine growth restriction. PMID: 26520690
  20. data indicate that PAPP-A promotes TF expression in human endothelial cells and support the hypothesis that this proteinase, besides being involved in progression of atherosclerosis, does not represent an independent risk factor for adverse cardiovascular events, but it rather might play an "active" role in the pathophysiology of ACS as an effector molecule able to induce a pro-thrombotic phenotype in endothelial cells PMID: 27007282
  21. assessed serum PAPP-A levels in COPD and the associations with disease severity; elevated levels of PAPP-A were observed in patients with COPD PMID: 27090654
  22. STC2 is involved in regulating PAPP-A activity during the development of atherosclerosis PMID: 26983002
  23. Data suggest that stanniocalcin 1 and 2 (STC1, STC2) participate in inhibition of proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) during folliculogenesis. PMID: 26874357
  24. measurements of maternal serum PAPP-A concentration in the first trimester predict severe fetal growth restriction more effectively than they predict a birth weight below the 10th percentile among a Chinese population PMID: 25845987
  25. Women with PAPP-A /=90th percentile is protective against small for gestational age, and is associated with an increased risk of large for gestational age for infants born after 32 weeks gestation. PMID: 26773241
  26. Data suggest that incidences of intrauterine growth restriction, pre-eclampsia, preterm birth, and fetal death are significantly greater in pregnant women with low serum levels of PAPP-A in first trimester (9-13 weeks of pregnancy) as compared to control pregnant women; study was conducted in India. PMID: 25773764
  27. The first trimester maternal PAPP-A levels were decreased in the ICSI group compared with those in the controls, but not in IVF and embryo transfer groups. PMID: 26697810
  28. miR-141 may play important roles in ox-LDL-induced abnormal proliferation of the vascular smooth muscle cells by targeting PAPPA. PMID: 26823756
  29. Combined analysis of PAPP-A and free beta-hCG appears to be a potential candidate to predict early fetal loss. PMID: 25159705
  30. PAPP-A in ascites and tissue-associated PAPP-A serve to increase IGF bioactivity and, thereby, to stimulate IGF-IR-mediated ovarian tumor growth. PMID: 26336825
  31. PAPP-A determination during the first trimester of pregnancy in women at risk for IUGR makes possible the prophylactic treatment and monitoring of pregnancy. PMID: 27125092
  32. Data indicate that rising pregnancy-associated plasma protein-A (PAPP-A) levels are prognostic in patients with coronary artery disease (CAD). PMID: 26223809
  33. PAPP-A serum concentrations differed significantly between Asian and European women during the first trimester of pregnancy. PMID: 25858516
  34. The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability. PMID: 26214492
  35. For Down syndrome affected pregnancies, the median MoM of first trimester PAPP-A, PlGF, and AFP were significantly reduced, and free-beta-hCG were significantly elevated. PMID: 25846403
  36. Increased PAPP-A in the first trimester is associated with placenta accreta. PMID: 24226752
  37. Maternal serum PAPP-A was not associated with fetal open spina bifida. PMID: 24226839
  38. The A>C variation of rs7020782 of PAPPA might be an independent risk factor for carotid plaque development and calcification. PMID: 26122709
  39. Elevated PAPP-A was associated with fetal macrosomia. PMID: 24155168
  40. Suggest that PAPP-A is specifically involved in the regulation of steroidogenesis in human antral follicles. PMID: 26297643
  41. The performance of screening for GDM by maternal factors was not improved by the addition of PAPP-A and/or PLGF. First trimester maternal serum PAPP-A and PLGF are not useful in screening for GDM. PMID: 26362726
  42. serum variations during the first trimester cannot be used as a marker of excessive fetal growth PMID: 24940710
  43. Data suggest both serum PAPP-A and serum CRP (high-sensitivity C-reactive protein) are up-regulated during first trimester in women who will undergo early pregnancy failure. PMID: 25596909
  44. PAPPA was similar between pregnant women with chronic kidney disease and controls. PMID: 25395363
  45. Median PAPP-A MoM was 1.01 in the control group and 1.05 (P = 0.83) in praevia, compared with 1.22 in abnormally invasive placentation cases (0.16). PMID: 25639820
  46. A PAPP-A value, expressed in MoM, of 1.25 is a predictive factor of fetal birth weight >4000 g PMID: 24743523
  47. first trimester PAPP-A levels were measured to see if they were associated with negative pregnancy outcome. Groups with high and low PAPP-A significantly differed only in miscarriages. PMID: 25139218
  48. inadequate sensitivity as first trimester serum marker for pre-eclampsia PMID: 24786703
  49. Serum PAPP-A levels were closely associated with the coronary no-reflow phenomenon during percutaneous coronary intervention. PMID: 24227626
  50. High PAPP-A expression is associated with breast cancer. PMID: 25468445

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Peptidase M43B family
Tissue Specificity
High levels in placenta and pregnancy serum. In placenta, expressed in X cells in septa and anchoring villi, and in syncytiotrophoblasts in the chorionic villi. Lower levels are found in a variety of other tissues including kidney, myometrium, endometrium
Database Links

HGNC: 8602

OMIM: 176385

KEGG: hsa:5069

STRING: 9606.ENSP00000330658

UniGene: Hs.643599

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×